Warning: Undefined array key "HTTP_ACCEPT_LANGUAGE" in /var/www/vhosts/angoloufficio.it/httpdocs/modules/psrecaptcha/psrecaptcha.php on line 666
portaetichette - cavalierini
prodotto aggiunto alla lista
Prodotto aggiunto per il confronto.
Load Time 1149 ms
Querying Time 874 ms
Queries 921
Memory Peak Usage 23.3 Mb
Included Files 1413 files - 18.11 Mb
PrestaShop Cache - Mb
Global vars 1.39 Mb
PrestaShop Version 8.1.5
PHP Version 8.1.28
MySQL Version 10.1.48-MariaDB-0ubuntu0.18.04.1
Memory Limit 1024M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 22.739 ms 22.739 ms 3.85 Mb 3.9 Mb
__construct 0.022 ms 22.761 ms - Mb 3.9 Mb
init 29.997 ms 52.758 ms 0.69 Mb 4.9 Mb
checkAccess 0.001 ms 52.759 ms - Mb 4.9 Mb
setMedia 6.151 ms 58.910 ms 0.17 Mb 4.9 Mb
postProcess 0.004 ms 58.914 ms - Mb 4.9 Mb
initHeader 0.001 ms 58.915 ms - Mb 4.9 Mb
initContent 1008 ms 1067 ms 11.09 Mb 18.7 Mb
initFooter 0.002 ms 1067 ms - Mb 18.7 Mb
display 81.868 ms 1149 ms 6.39 Mb 23.3 Mb
Hook Time Memory Usage
DisplayHeader 340.138 ms 7.40 Mb
DisplayBeforeBodyClosingTag 12.786 ms 0.17 Mb
DisplayProductPriceBlock 9.934 ms 0.80 Mb
DisplayFooter 7.187 ms 0.40 Mb
DisplayAfterTitleTag 5.238 ms 0.57 Mb
ActionFrontControllerSetMedia 4.802 ms 0.12 Mb
displayBeforeBodyClosingTag 4.466 ms 0.50 Mb
DisplayFooterCategory 3.683 ms 0.11 Mb
DisplayTop 3.257 ms 0.16 Mb
displayLeftColumn 2.557 ms 0.08 Mb
displayNav2 2.040 ms 0.18 Mb
Header 1.970 ms 0.08 Mb
displayFooter 1.698 ms 0.11 Mb
displayMainMenu 1.463 ms 0.89 Mb
renderWidget 1.321 ms 0.15 Mb
displayNav1 1.017 ms 0.09 Mb
displayProductListReviews 0.965 ms 0.12 Mb
DisplayAfterBodyOpeningTag 0.695 ms 0.04 Mb
displayCategoryElementor 0.685 ms 0.08 Mb
displayProductListFunctionalButtons 0.628 ms 0.01 Mb
DisplayLeftColumn 0.589 ms 0.04 Mb
displayNavCenter 0.589 ms 0.06 Mb
displayAfterBreadcrumb 0.505 ms 0.04 Mb
ActionDispatcherBefore 0.491 ms 0.01 Mb
DisplayProductListReviews 0.444 ms 0.03 Mb
ProductSearchProvider 0.323 ms 0.01 Mb
IsJustElementor 0.241 ms 0.02 Mb
DisplayFooterAfter 0.233 ms 0.01 Mb
ModuleRoutes 0.088 ms 0.03 Mb
OverrideLayoutTemplate 0.049 ms - Mb
ActionDispatcher 0.016 ms - Mb
displayVerticalMenu 0.014 ms - Mb
ActionFrontControllerInitAfter 0.012 ms - Mb
DisplayFooterBefore 0.009 ms - Mb
ActionProductSearchAfter 0.006 ms - Mb
35 hook(s) 410.140 ms 12.30 Mb
Module Time Memory Usage
doofinder 2.569 ms - Mb
ybc_blog 15.615 ms 0.60 Mb
simpleimportproduct 6.853 ms 0.35 Mb
ets_abandonedcart 8.875 ms 0.17 Mb
ps_mbo 3.294 ms 0.11 Mb
iqitthemeeditor 13.010 ms 0.26 Mb
ps_emailsubscription 0.290 ms 0.01 Mb
ps_emailalerts 0.162 ms 0.01 Mb
ps_checkout 4.844 ms - Mb
ps_accounts 0.327 ms - Mb
psrecaptcha 0.398 ms 0.17 Mb
revsliderprestashop 1.337 ms 0.03 Mb
arteinvoice 0.711 ms 0.03 Mb
lgcookieslaw 10.334 ms 0.49 Mb
ps_shoppingcart 0.245 ms 0.01 Mb
productcomments 0.176 ms 0.01 Mb
iqitcompare 1.668 ms 0.04 Mb
iqitcontactpage 1.194 ms 0.07 Mb
iqitcountdown 0.257 ms 0.01 Mb
iqitelementor 1.428 ms 0.11 Mb
iqitfreedeliverycount 0.153 ms 0.01 Mb
iqitmegamenu 1.708 ms 0.90 Mb
iqitreviews 1.074 ms 0.13 Mb
iqitwishlist 5.411 ms 0.55 Mb
iqitextendedproduct 0.237 ms 0.01 Mb
artproduttori 0.690 ms 0.05 Mb
ganalyticspro 266.439 ms 6.37 Mb
shinystat 0.783 ms 0.02 Mb
ets_integrategooglemarketing 0.770 ms 0.03 Mb
cdc_googletagmanager 6.084 ms 0.62 Mb
gremarketing 58.190 ms 0.56 Mb
gmerchantcenterpro 42.156 ms 0.39 Mb
connettore 0.723 ms 0.05 Mb
feedaty 4.626 ms 0.14 Mb
tec_dataminimizer 0.180 ms 0.01 Mb
ec_minorder 0.395 ms 0.01 Mb
multipleprices 9.176 ms 0.73 Mb
payplug 8.509 ms 0.38 Mb
sendinblue 0.659 ms 0.01 Mb
absfrequentlyboughttogether 0.290 ms 0.01 Mb
trustedprogramintegration 0.342 ms 0.01 Mb
ps_facetedsearch 1.126 ms 0.07 Mb
iqitlinksmanager 1.841 ms 0.13 Mb
iqithtmlandbanners 1.349 ms 0.08 Mb
ps_languageselector 0.414 ms 0.05 Mb
ps_currencyselector 0.466 ms 0.05 Mb
iqitsearch 1.042 ms 0.06 Mb
ps_customersignin 0.729 ms 0.09 Mb
pagesnotfound 0.077 ms 0.01 Mb
iqitproductsnav 0.925 ms 0.04 Mb
ps_categorytree 2.740 ms 0.10 Mb
statsdata 12.492 ms 0.17 Mb
52 module(s) 505.383 ms 14.20 Mb

Stopwatch SQL - 921 queries

# Query Time (ms) Rows Filesort Group By Location
543
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 295 ORDER BY vl.`value` ASC
52.861 ms 3112 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
562
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
37.834 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
574
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 295 ORDER BY vl.`value` ASC
28.865 ms 3112 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
524
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1)
23.736 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:91
560
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 281 ORDER BY vl.`value` ASC
21.266 ms 561 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
558
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 280 ORDER BY vl.`value` ASC
20.637 ms 507 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
554
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `uag_manufacturer` m INNER JOIN uag_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `uag_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
15.555 ms 738 Yes /classes/Manufacturer.php:211
372
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23352) LIMIT 1
12.437 ms 1 /src/Adapter/EntityMapper.php:71
536
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 8086 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
12.360 ms 27 /classes/Category.php:1062
32
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
11.942 ms 129 /classes/module/Module.php:345
686
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=414)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
11.653 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
750
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=479)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
8.619 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
461
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23582) LIMIT 1
8.213 ms 1 /src/Adapter/EntityMapper.php:71
915
INSERT INTO `uag_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
7.604 ms 1 /classes/ObjectModel.php:622
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
6.952 ms 129 /classes/module/Module.php:345
373
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23352 AND `id_shop` = 1
6.783 ms 1 /src/Adapter/EntityMapper.php:79
381
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23354 AND `id_shop` = 1
5.760 ms 1 /src/Adapter/EntityMapper.php:79
549
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
5.754 ms 718 Yes /classes/Category.php:724
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `uag_configuration` c
LEFT JOIN `uag_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
5.295 ms 2111 /classes/Configuration.php:180
741
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=470)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
5.282 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
555
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) GROUP BY p.id_manufacturer
4.946 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
526
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'IT' LIMIT 1
4.634 ms 1 /classes/Country.php:194
210
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23534)
4.512 ms 1 /classes/Product.php:3860
76
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `uag_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `uag_hook_alias` ha
INNER JOIN `uag_hook` h ON ha.name = h.name
4.369 ms 0 /classes/Hook.php:1292
742
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=471)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
4.088 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `uag_module` m
INNER JOIN uag_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `uag_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `uag_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `uag_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
4.047 ms 202 Yes Yes /classes/Hook.php:1233
559
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=281)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
3.948 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
738
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=467)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
3.534 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
375
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23352 LIMIT 1
3.507 ms 1 /classes/Product.php:1106
532
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 19
3.504 ms 1 /src/Adapter/EntityMapper.php:79
542
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `uag_feature` f  INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `uag_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
3.453 ms 280 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
777
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=506)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
3.386 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
380
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23354) LIMIT 1
3.210 ms 1 /src/Adapter/EntityMapper.php:71
754
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=483)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
3.199 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
249
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23538)
3.130 ms 1 /classes/Product.php:3860
570
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=292)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.860 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
720
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=449)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.763 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
77
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `uag_hook_module` hm
STRAIGHT_JOIN `uag_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `uag_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.643 ms 666 /classes/Hook.php:456
759
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=488)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.564 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
828
REPLACE INTO uag_layered_filter_block (hash, data) VALUES ("5cbd4e9eff6502983d6492c220c2831c", "a:1:{s:7:\"filters\";a:8:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:9:\"Categorie\";s:6:\"values\";a:0:{}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilità\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:12:\"In magazzino\";s:3:\"nbr\";i:1;}i:0;a:2:{s:4:\"name\";s:15:\"Non disponibile\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:1:{i:69483;a:2:{s:4:\"name\";s:11:\"Djois by 3L\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:3;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Prezzo\";s:3:\"max\";d:4;s:3:\"min\";d:3;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:1;s:5:\"value\";N;}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:280;s:6:\"values\";a:1:{i:22;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Trasparente\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Colore\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:281;s:6:\"values\";a:1:{i:41;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:3:\"PPL\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Materiale\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:6;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:282;s:6:\"values\";a:1:{i:58;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:22:\"Portaetichette adesive\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Tipologia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:7;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:295;s:6:\"values\";a:22:{i:65171;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"16 x 63mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65374;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"22 x 102mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65172;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"24 x 63mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65173;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"24 x 88mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65175;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"24 x 124mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65373;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"25 x 75mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65571;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"30 x 75mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65573;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"30 x 100mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65174;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"32 x 88mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65176;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"32 x 124mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65347;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"35 x 102mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65572;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"40 x 75mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65574;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"40 x 100mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65179;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"40 x 300mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65348;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"46 x 75mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65349;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"55 x 102mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65375;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"55 x 150mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65575;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"60 x 100mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65350;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"62 x 150mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65177;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"65 x 100mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65178;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"65 x 140mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65351;a:5:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"75 x 150mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}}s:4:\"name\";s:10:\"Dimensione\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}}}")
2.388 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
569
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=291)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.335 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
556
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM uag_product p INNER JOIN uag_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135
2.308 ms 1 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
68
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 8086 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
2.276 ms 27 /classes/Category.php:1062
179
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23356
AND image_shop.`cover` = 1 LIMIT 1
2.249 ms 1 /classes/Product.php:3570
551
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value=65351))
2.244 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
168
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23354 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23354 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
2.197 ms 0 /classes/Cart.php:1423
744
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=473)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.141 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
169
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23354
ORDER BY f.position ASC
2.085 ms 4 Yes /classes/Product.php:6015
557
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=280)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.007 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
565
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=287)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
2.002 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
91
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23345)
1.994 ms 1 /classes/Product.php:3860
682
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=410)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.919 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
358
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23350
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
1.896 ms 0 /classes/Product.php:1732
775
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=504)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.864 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
568
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=290)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.848 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
745
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=474)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.831 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
749
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=478)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.830 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
684
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=412)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.800 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
573
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=295)) GROUP BY fp.id_feature_value
1.776 ms 50682060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
734
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=463)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.715 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
648
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=374)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.700 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
564
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=284)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.667 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
561
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=282)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.608 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
731
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=460)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.599 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
138
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23350 AND `id_group` = 1 LIMIT 1
1.596 ms 0 /classes/GroupReduction.php:156
764
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=493)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.559 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
690
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=418)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.554 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
553
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value=65351))
1.504 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
613
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=337)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.473 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
541
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM uag_layered_category
WHERE controller = 'category'
AND id_category = 8086
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
1.465 ms 270 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
21
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
1.457 ms 1 Yes Yes /classes/Supplier.php:139
273
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23583 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23583 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.457 ms 0 /classes/Cart.php:1423
733
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=462)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.456 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
552
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value=65351))
1.443 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
349
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23349 AND `id_shop` = 1
1.437 ms 1 /src/Adapter/EntityMapper.php:79
515
SHOW TABLES LIKE "uag_gmcp_1800"
1.435 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
563
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=283)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.423 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
170
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23355
AND image_shop.`cover` = 1 LIMIT 1
1.420 ms 1 /classes/Product.php:3570
688
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=416)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.412 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
757
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=486)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.410 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
751
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=480)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.399 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
525
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.iso_lang="it") AND (ff.id_shop=1)
1.391 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:109
755
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=484)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.391 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
760
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=489)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.381 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
412
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23358) LIMIT 1
1.371 ms 1 /src/Adapter/EntityMapper.php:71
356
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23350) LIMIT 1
1.371 ms 1 /src/Adapter/EntityMapper.php:71
740
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=469)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.357 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
547
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351))
1.336 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
685
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=413)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.312 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
23
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*
FROM `uag_feature` f
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1)
ORDER BY f.`position` ASC
1.308 ms 280 Yes /classes/Feature.php:92
691
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=419)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.307 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
905
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `uag_category` c
INNER JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `uag_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 9
AND nleft >= 134 AND nright <= 135
AND c.id_category IN (
SELECT id_category
FROM `uag_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cl.`name` ASC
1.299 ms 66 Yes /modules/ps_categorytree/ps_categorytree.php:166
575
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=296)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.298 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
722
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=451)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.292 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
768
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=497)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.292 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
364
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23351) LIMIT 1
1.284 ms 1 /src/Adapter/EntityMapper.php:71
550
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND cg.id_group='1' AND c.level_depth<=6 AND c.nleft>134 AND c.nright<135 GROUP BY cp.id_category
1.284 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
571
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=293)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.281 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
919
INSERT INTO `uag_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('708', '4051', '59795485', '', '1', '1', '2024-05-08 14:20:27')
1.275 ms 1 /classes/ObjectModel.php:622
732
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=461)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.271 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
359
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23350 LIMIT 1
1.268 ms 1 /classes/Product.php:1106
746
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=475)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.265 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
250
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23538 AND id_shop=1 LIMIT 1
1.263 ms 1 /classes/Product.php:6870
676
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=403)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.256 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
735
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=464)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.246 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
48
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `uag_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 8086
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.245 ms 1 Yes Yes /classes/Category.php:924
756
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=485)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.238 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
826
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=560)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.231 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
593
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=315)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.227 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
377
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.224 ms 1 /classes/stock/StockAvailable.php:778
323
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.219 ms 1 /classes/stock/StockAvailable.php:806
697
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=425)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.213 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
475
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23583) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.206 ms 1 /classes/stock/StockAvailable.php:753
758
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=487)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.200 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
687
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=415)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.195 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
753
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=482)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.189 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
748
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=477)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.185 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
795
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=524)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.176 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
743
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=472)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.171 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
747
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=476)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.160 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
778
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=507)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.155 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
612
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=336)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.154 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
606
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=329)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.137 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
752
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=481)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.137 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
644
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=370)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.135 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
620
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=344)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.128 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
673
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=400)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.117 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
727
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=456)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.117 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
902
SELECT SQL_NO_CACHE p.*,pc.id_category, pl.image,pl.thumb, pl.title, pl.description, pl.short_description, pl.meta_keywords, pl.meta_description,pl.url_alias,e.firstname, e.lastname,pc.position,count(pcm.id_comment) as total_comment,IFNULL(ybe.status,1) as status
FROM `uag_ybc_blog_post` p
INNER JOIN `uag_ybc_blog_post_shop` ps ON (p.id_post=ps.id_post AND ps.id_shop='1')
LEFT JOIN `uag_ybc_blog_post_lang` pl ON p.id_post = pl.id_post AND pl.id_lang = 1
LEFT JOIN `uag_ybc_blog_post_category` pc ON (p.id_post = pc.id_post ) 
LEFT JOIN `uag_ybc_blog_post_related_categories` rpc ON (p.id_post = rpc.id_post)
LEFT JOIN `uag_customer` c ON (c.id_customer=p.added_by AND p.is_customer=1)
LEFT JOIN `uag_employee` e ON (e.id_employee=p.added_by AND p.is_customer=0)
LEFT JOIN `uag_ybc_blog_employee` ybe ON ((ybe.id_employee=c.id_customer AND ybe.is_customer=1) OR (ybe.id_employee=e.id_employee AND ybe.is_customer=0))
LEFT JOIN `uag_ybc_blog_comment` pcm on (pcm.id_post=p.id_post)
WHERE 1  AND p.enabled=1 AND rpc.id_category=8086  
GROUP BY p.id_post
ORDER BY p.datetime_added DESC,  p.id_post DESC  LIMIT 0, 6
1.117 ms 1 Yes /modules/ybc_blog/classes/ybc_blog_post_class.php:262
572
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=294)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.107 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `uag_hook` h
WHERE (h.active = 1)
1.100 ms 1128 /classes/Hook.php:1332
770
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=499)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.099 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
624
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=348)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.098 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
809
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=539)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.094 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
653
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=379)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.094 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
628
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=352)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.092 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
704
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=432)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.092 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
776
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=505)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.080 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
586
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=307)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.068 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
739
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=468)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.065 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
782
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=511)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.065 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
786
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=515)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.065 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
729
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=458)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.064 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
566
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=288)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.063 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
652
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=378)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.063 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
609
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=333)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.062 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
643
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=369)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.061 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
726
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=455)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.060 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
610
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=334)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.059 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
585
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=306)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.059 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
611
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=335)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.058 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
817
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=547)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.057 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
625
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=349)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.055 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
654
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=380)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.053 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
730
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=459)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.053 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
588
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=309)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.043 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
376
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23352
1.036 ms 1 /classes/Tag.php:244
705
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=433)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.035 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
629
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=353)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.032 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
781
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=510)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.031 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
681
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=409)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.030 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
736
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=465)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.027 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
761
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=490)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.027 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
674
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=401)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.026 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
737
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=466)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.026 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
763
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=492)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.022 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
807
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=537)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.022 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
717
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=446)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.021 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
591
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=312)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.020 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
792
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=521)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.018 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
589
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=310)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.017 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
779
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=508)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.016 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
608
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=332)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.015 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
725
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=454)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.015 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
825
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=555)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.013 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
580
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=301)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.011 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
721
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=450)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.011 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
728
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=457)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.010 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
814
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=544)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.008 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
788
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=517)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.007 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
546
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC LIMIT 0, 36
1.005 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
789
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=518)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.003 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
797
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=526)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.002 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
665
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=392)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
1.001 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
894
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration` a
WHERE (a.`id_multipleprices_configuration` = 1) LIMIT 1
0.999 ms 1 /src/Adapter/EntityMapper.php:71
784
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=513)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.997 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
787
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=516)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.997 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
607
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=330)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.996 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
823
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=553)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.996 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
675
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=402)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.995 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
584
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=305)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.992 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
791
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=520)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.992 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
794
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=523)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.991 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
785
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=514)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.990 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
819
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=549)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.990 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
499
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.989 ms 1 /classes/stock/StockAvailable.php:778
663
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=390)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
818
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=548)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
20
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.987 ms 1 Yes Yes /classes/Supplier.php:139
601
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=324)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
723
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=452)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.986 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
621
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=345)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.985 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
718
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=447)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.983 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
799
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=528)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.983 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
822
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=552)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.982 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
579
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=300)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.981 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
664
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=391)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.981 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
211
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23534 AND id_shop=1 LIMIT 1
0.979 ms 1 /classes/Product.php:6870
783
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=512)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.979 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
578
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=299)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.978 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
679
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=407)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.976 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
678
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=406)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.975 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
666
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=393)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.974 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
623
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=347)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.972 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
767
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=496)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.972 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
798
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=527)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.971 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
815
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=545)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.970 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
680
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=408)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.967 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
813
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=543)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.967 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
661
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=388)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.964 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
724
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=453)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.964 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
630
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=354)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.962 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
820
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=550)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.962 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
603
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=326)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.961 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
592
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=314)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.958 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
694
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=422)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.956 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
800
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=529)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.955 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
645
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=371)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.954 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
672
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=399)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.953 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
695
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=423)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.953 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
812
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=542)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.953 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
796
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=525)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.952 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
711
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=439)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.951 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
793
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=522)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.949 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
587
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=308)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.947 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
658
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=385)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.946 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
696
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=424)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.944 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
790
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=519)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.943 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
646
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=372)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.941 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
657
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=384)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.941 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
668
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=395)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.941 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
780
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=509)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.939 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
590
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=311)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.939 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
920
INSERT INTO `uag_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('517', '', 'www.angoloufficio.it/8086-portaetichette-cavalierini?q=Dimensione-75+x+150mm&resultsPerPage=36', '', '2024-05-08 14:20:27')
0.938 ms 1 /classes/ObjectModel.php:622
309
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23344
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.938 ms 0 /classes/Product.php:1732
766
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=495)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.938 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
816
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=546)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.938 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
824
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=554)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.938 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
662
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=389)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.936 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
683
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=411)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.936 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
810
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=540)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.936 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
827
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=561)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.936 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
633
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=357)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.935 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
808
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=538)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.934 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
719
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=448)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.932 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
772
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=501)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.929 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
667
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=394)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.928 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
581
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=302)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.927 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
655
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=382)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.926 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
618
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=342)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.925 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
771
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=500)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.924 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
811
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=541)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.924 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
895
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration_lang`
WHERE `id_multipleprices_configuration` = 1
0.923 ms 1 /src/Adapter/EntityMapper.php:79
283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23584 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23584 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.923 ms 0 /classes/Cart.php:1423
821
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=551)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.922 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
594
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=316)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.921 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
614
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=338)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.921 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
773
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=502)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.921 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
631
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=355)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.920 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
801
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=530)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.919 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
692
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=420)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.913 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23727
AND image_shop.`cover` = 1 LIMIT 1
0.911 ms 1 /classes/Product.php:3570
635
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=359)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.906 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
660
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=387)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.904 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
671
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=398)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.904 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
576
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=297)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.900 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
634
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=358)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.898 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
627
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=351)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.896 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
602
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=325)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.893 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
642
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=368)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.892 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
604
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=327)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.885 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
651
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=377)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.885 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
659
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=386)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.885 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
619
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=343)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.880 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
25
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `uag_meta` m
LEFT JOIN `uag_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.877 ms 64 Yes /classes/Dispatcher.php:654
622
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=346)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.877 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
632
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=356)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.876 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
669
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=396)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.876 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
765
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=494)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.873 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
637
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=361)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.869 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
263
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23582 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23582 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.867 ms 0 /classes/Cart.php:1423
582
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=303)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.867 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
677
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=405)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.867 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
649
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=375)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.865 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
701
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=429)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.864 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
577
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=298)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.859 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
617
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=341)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.859 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
647
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=373)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.857 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
583
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=304)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.853 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
600
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=323)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.852 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
670
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=397)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.851 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
706
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=434)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.849 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
689
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=417)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.848 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
774
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=503)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.837 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
805
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=535)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.836 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
595
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=317)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.834 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
615
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=339)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.831 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
640
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=366)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.831 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
272
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23583) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.829 ms 1 /classes/stock/StockAvailable.php:453
616
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=340)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.828 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
762
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=491)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.828 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
597
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=319)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.825 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
626
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=350)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.824 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
802
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=532)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.822 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
769
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=498)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.818 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
360
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23350
0.817 ms 1 /classes/Tag.php:244
69
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23344
AND image_shop.`cover` = 1 LIMIT 1
0.811 ms 1 /classes/Product.php:3570
599
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=322)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.808 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
804
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=534)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.801 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
636
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=360)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.800 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
709
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=437)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.799 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
712
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=440)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.798 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
656
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=383)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.796 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
504
SELECT SQL_NO_CACHE g.id_group as value, gl.name as label FROM `uag_group` g
LEFT JOIN `uag_group_lang` gl ON (g.id_group=gl.id_group AND gl.id_lang="1")
WHERE g.id_group !="1" AND g.id_group !="2"
0.796 ms 6 /modules/ybc_blog/ybc_blog_defines.php:3038
650
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=376)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.794 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
714
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=443)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.792 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
548
SELECT SQL_NO_CACHE data FROM uag_layered_filter_block WHERE hash="5cbd4e9eff6502983d6492c220c2831c" LIMIT 1
0.791 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
713
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=441)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.785 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
698
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=426)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.783 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
803
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=533)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.783 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
707
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=435)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.781 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
641
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=367)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.778 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
257
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23582) AND (b.`id_shop` = 1) LIMIT 1
0.773 ms 1 /src/Adapter/EntityMapper.php:71
596
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=318)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.771 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
806
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=536)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.768 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
605
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=328)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.766 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
710
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=438)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.763 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
567
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=289)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.757 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
702
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=430)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.753 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
708
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=436)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.747 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
159
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23352
ORDER BY f.position ASC
0.746 ms 4 Yes /classes/Product.php:6015
598
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=320)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.740 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
699
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=427)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.737 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
33
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8086) AND (b.`id_shop` = 1) LIMIT 1
0.734 ms 1 /src/Adapter/EntityMapper.php:71
140
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23350 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23350 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.728 ms 0 /classes/Cart.php:1423
700
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=428)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.725 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
638
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=362)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.717 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
300
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23728 AND id_shop=1 LIMIT 1
0.716 ms 1 /classes/Product.php:6870
716
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=445)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.714 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
908
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.710 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
294
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23727
ORDER BY f.position ASC
0.707 ms 5 Yes /classes/Product.php:6015
639
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=363)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.706 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
264
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23582
ORDER BY f.position ASC
0.704 ms 4 Yes /classes/Product.php:6015
703
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=431)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.701 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
287
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23727) AND (b.`id_shop` = 1) LIMIT 1
0.697 ms 1 /src/Adapter/EntityMapper.php:71
507
DESCRIBE uag_ybc_blog_post
0.693 ms 1 /modules/ybc_blog/ybc_blog_defines.php:3141
141
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23350
ORDER BY f.position ASC
0.690 ms 4 Yes /classes/Product.php:6015
693
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=421)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.686 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
715
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=65351)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=134 AND c.nright<=135 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=444)) AND ((fp_1.id_feature_value=65351)) GROUP BY fp.id_feature_value
0.683 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `uag_hook`
0.675 ms 1128 /classes/Hook.php:1292
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.662 ms 129 /classes/module/Module.php:345
27
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.661 ms 129 /classes/module/Module.php:345
274
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23583
ORDER BY f.position ASC
0.661 ms 4 Yes /classes/Product.php:6015
281
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23584 AND `id_group` = 1 LIMIT 1
0.659 ms 0 /classes/GroupReduction.php:156
65
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.638 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
243
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23537 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23537 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.638 ms 0 /classes/Cart.php:1423
131
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23349 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23349 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.635 ms 0 /classes/Cart.php:1423
271
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23583 AND `id_group` = 1 LIMIT 1
0.633 ms 0 /classes/GroupReduction.php:156
278
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23584 LIMIT 1
0.626 ms 1 /classes/SpecificPrice.php:435
528
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.614 ms 1 /classes/Currency.php:893
85
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23344 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23344 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.605 ms 0 /classes/Cart.php:1423
244
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23537
ORDER BY f.position ASC
0.605 ms 4 Yes /classes/Product.php:6015
509
SELECT SQL_NO_CACHE ac.id_ets_abancart_campaign
FROM `uag_ets_abancart_campaign` ac
LEFT JOIN `uag_ets_abancart_campaign_country` `cc` ON cc.id_ets_abancart_campaign = ac.id_ets_abancart_campaign
LEFT JOIN `uag_ets_abancart_campaign_with_lang` `cl` ON cl.id_ets_abancart_campaign = ac.id_ets_abancart_campaign AND cl.id_lang=1
LEFT JOIN `uag_ets_abancart_campaign_group` `acg` ON ac.id_ets_abancart_campaign = acg.id_ets_abancart_campaign
LEFT JOIN `uag_group_shop` `gs` ON gs.id_group = acg.id_group AND gs.id_shop = 1
WHERE (ac.id_shop = 1) AND (ac.enabled = 1 AND ac.deleted = 0) AND (IF(ac.is_all_lang != 1, cl.id_ets_abancart_campaign is NOT NULL AND cl.id_lang=1, 1)) AND (ac.campaign_type != 'email') AND (ac.campaign_type != 'customer') AND (IF(ac.min_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.min_total_cart <= 0, 1) AND IF(ac.max_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.max_total_cart >= 0, 1)) AND (IF(ac.available_from is NOT NULL, ac.available_from <= '2024-05-08', 1) AND IF(ac.available_to is NOT NULL, ac.available_to >= '2024-05-08', 1)) AND (IF(ac.has_applied_voucher = 'both' OR (ac.has_applied_voucher = 'yes' AND 0 > 0) OR (ac.has_applied_voucher = 'no' AND 0 = 0), 1, 0)) AND (IF(ac.has_product_in_cart = 1, 0, 1)) AND (acg.id_group = 1) AND (ac.is_all_country = 1 OR cc.id_country = -1 OR cc.id_country=10)
GROUP BY ac.id_ets_abancart_campaign
0.597 ms 1 Yes /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:407
87
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.596 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:109
78
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.590 ms 2 Yes /classes/tax/TaxRulesTaxManager.php:109
26
SELECT SQL_NO_CACHE * FROM `uag_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.587 ms 1 /classes/module/Module.php:2018
113
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23347 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23347 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.583 ms 0 /classes/Cart.php:1423
293
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23727 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23727 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.582 ms 0 /classes/Cart.php:1423
829
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-05-08 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM uag_product p
LEFT JOIN uag_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN uag_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN uag_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (23538)
0.581 ms 1 /classes/ProductAssembler.php:95
50
SELECT SQL_NO_CACHE 1 FROM uag_cart_product cp INNER JOIN uag_product p
ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.580 ms 1 /classes/Cart.php:4210
268
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23583 LIMIT 1
0.579 ms 1 /classes/SpecificPrice.php:435
133
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23350
AND image_shop.`cover` = 1 LIMIT 1
0.578 ms 1 /classes/Product.php:3570
223
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23535 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23535 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.578 ms 0 /classes/Cart.php:1423
135
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23350 LIMIT 1
0.576 ms 1 /classes/SpecificPrice.php:435
464
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23582 LIMIT 1
0.576 ms 1 /classes/Product.php:1106
217
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.570 ms 1 /classes/Product.php:5655
186
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23356 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23356 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.567 ms 0 /classes/Cart.php:1423
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.564 ms 129 /classes/module/Module.php:345
34
SELECT SQL_NO_CACHE * FROM `uag_currency` c ORDER BY `iso_code` ASC
0.558 ms 1 Yes /classes/Currency.php:709
178
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23355
ORDER BY f.position ASC
0.557 ms 4 Yes /classes/Product.php:6015
884
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (23538) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.556 ms 1 Yes Yes /classes/Product.php:4520
105
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23346
ORDER BY f.position ASC
0.542 ms 4 Yes /classes/Product.php:6015
104
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23346 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23346 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.542 ms 0 /classes/Cart.php:1423
123
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23348
ORDER BY f.position ASC
0.538 ms 4 Yes /classes/Product.php:6015
177
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23355 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23355 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.535 ms 0 /classes/Cart.php:1423
95
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23345 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23345 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.529 ms 0 /classes/Cart.php:1423
286
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.526 ms 1 /classes/Product.php:5655
162
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23354) AND (b.`id_shop` = 1) LIMIT 1
0.522 ms 1 /src/Adapter/EntityMapper.php:71
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23357 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23357 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.521 ms 0 /classes/Cart.php:1423
214
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23534 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23534 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.519 ms 0 /classes/Cart.php:1423
297
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23728) AND (b.`id_shop` = 1) LIMIT 1
0.514 ms 1 /src/Adapter/EntityMapper.php:71
19
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.513 ms 129 /classes/module/Module.php:345
237
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23537) AND (b.`id_shop` = 1) LIMIT 1
0.508 ms 1 /src/Adapter/EntityMapper.php:71
182
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23356)
0.500 ms 1 /classes/Product.php:3860
38
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.499 ms 1 /src/Adapter/EntityMapper.php:71
233
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23536 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23536 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.497 ms 0 /classes/Cart.php:1423
132
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23349
ORDER BY f.position ASC
0.495 ms 4 Yes /classes/Product.php:6015
247
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23538) AND (b.`id_shop` = 1) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
328
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23346
0.490 ms 1 /classes/Tag.php:244
224
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23535
ORDER BY f.position ASC
0.488 ms 4 Yes /classes/Product.php:6015
86
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23344
ORDER BY f.position ASC
0.486 ms 4 Yes /classes/Product.php:6015
378
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.482 ms 1 /classes/stock/StockAvailable.php:753
200
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23358)
0.480 ms 1 /classes/Product.php:3860
303
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23728 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23728 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.480 ms 0 /classes/Cart.php:1423
187
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23356
ORDER BY f.position ASC
0.476 ms 4 Yes /classes/Product.php:6015
149
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23351 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23351 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.474 ms 0 /classes/Cart.php:1423
114
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23347
ORDER BY f.position ASC
0.468 ms 4 Yes /classes/Product.php:6015
96
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23345
ORDER BY f.position ASC
0.467 ms 4 Yes /classes/Product.php:6015
122
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23348 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23348 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.467 ms 0 /classes/Cart.php:1423
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23357
ORDER BY f.position ASC
0.466 ms 4 Yes /classes/Product.php:6015
204
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23358 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23358 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.462 ms 0 /classes/Cart.php:1423
284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23584
ORDER BY f.position ASC
0.462 ms 4 Yes /classes/Product.php:6015
234
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23536
ORDER BY f.position ASC
0.461 ms 4 Yes /classes/Product.php:6015
332
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23347) LIMIT 1
0.460 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.457 ms 3 /classes/CartRule.php:357
173
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23355)
0.455 ms 1 /classes/Product.php:3860
522
COMMIT
0.454 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:100
215
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23534
ORDER BY f.position ASC
0.448 ms 4 Yes /classes/Product.php:6015
267
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23583) AND (b.`id_shop` = 1) LIMIT 1
0.447 ms 1 /src/Adapter/EntityMapper.php:71
265
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23583
AND image_shop.`cover` = 1 LIMIT 1
0.446 ms 1 /classes/Product.php:3570
357
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23350 AND `id_shop` = 1
0.446 ms 1 /src/Adapter/EntityMapper.php:79
893
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:20:27" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:20:27" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69483, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.439 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
139
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.431 ms 1 /classes/stock/StockAvailable.php:453
227
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23536) AND (b.`id_shop` = 1) LIMIT 1
0.429 ms 1 /src/Adapter/EntityMapper.php:71
109
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23347)
0.426 ms 1 /classes/Product.php:3860
485
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23727) LIMIT 1
0.426 ms 1 /src/Adapter/EntityMapper.php:71
901
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:20:27" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:20:27" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69483, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.425 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
67
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.424 ms 0 /classes/module/Module.php:2636
163
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23354 LIMIT 1
0.423 ms 1 /classes/SpecificPrice.php:435
254
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23538
ORDER BY f.position ASC
0.423 ms 4 Yes /classes/Product.php:6015
17
SELECT SQL_NO_CACHE name, alias FROM `uag_hook_alias`
0.422 ms 88 /classes/Hook.php:339
153
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23352 LIMIT 1
0.419 ms 1 /classes/SpecificPrice.php:435
269
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23583)
0.419 ms 1 /classes/Product.php:3860
280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23584 AND id_shop=1 LIMIT 1
0.412 ms 1 /classes/Product.php:6870
277
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23584) AND (b.`id_shop` = 1) LIMIT 1
0.410 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM uag_shop_group gs
LEFT JOIN uag_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN uag_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.404 ms 1 Yes /classes/shop/Shop.php:715
253
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23538 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23538 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.404 ms 0 /classes/Cart.php:1423
304
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23728
ORDER BY f.position ASC
0.404 ms 5 Yes /classes/Product.php:6015
916
SELECT SQL_NO_CACHE `id_guest`
FROM `uag_connections`
WHERE `id_guest` = 708
AND `date_add` > '2024-05-08 13:50:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.403 ms 1 Yes /classes/Connection.php:168
191
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23357)
0.402 ms 1 /classes/Product.php:3860
235
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23537
AND image_shop.`cover` = 1 LIMIT 1
0.402 ms 1 /classes/Product.php:3570
340
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23348) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
348
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23349) LIMIT 1
0.402 ms 1 /src/Adapter/EntityMapper.php:71
142
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23351
AND image_shop.`cover` = 1 LIMIT 1
0.397 ms 1 /classes/Product.php:3570
324
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23346) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
838
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 134 AND c.`nright` >= 135 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.396 ms 69 /classes/Category.php:1600
316
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23345) LIMIT 1
0.394 ms 1 /src/Adapter/EntityMapper.php:71
850
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 134 AND c.`nright` >= 135 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.392 ms 69 /classes/Category.php:1600
238
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23537 LIMIT 1
0.391 ms 1 /classes/SpecificPrice.php:435
469
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23583) LIMIT 1
0.388 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23536
AND image_shop.`cover` = 1 LIMIT 1
0.386 ms 1 /classes/Product.php:3570
279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23584)
0.386 ms 1 /classes/Product.php:3860
379
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.385 ms 1 /classes/stock/StockAvailable.php:806
158
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23352 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23352 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.383 ms 0 /classes/Cart.php:1423
481
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23584
0.379 ms 1 /classes/Tag.php:244
57
SELECT SQL_NO_CACHE * FROM `uag_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.379 ms 8 Yes /classes/ImageType.php:109
150
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23351
ORDER BY f.position ASC
0.378 ms 4 Yes /classes/Product.php:6015
494
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23728) LIMIT 1
0.376 ms 1 /src/Adapter/EntityMapper.php:71
317
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23345 AND `id_shop` = 1
0.375 ms 1 /src/Adapter/EntityMapper.php:79
107
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.374 ms 1 /classes/Product.php:5655
66
SELECT SQL_NO_CACHE * FROM uag_revslider_sliders
0.373 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
124
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23349
AND image_shop.`cover` = 1 LIMIT 1
0.372 ms 1 /classes/Product.php:3570
531
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
102
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23346 AND `id_group` = 1 LIMIT 1
0.369 ms 0 /classes/GroupReduction.php:156
226
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.369 ms 1 /classes/Product.php:5655
363
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.369 ms 1 /classes/stock/StockAvailable.php:806
299
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23728)
0.367 ms 1 /classes/Product.php:3860
305
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23344) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
335
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23347 LIMIT 1
0.366 ms 1 /classes/Product.php:1106
420
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23534) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
830
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 23538
ORDER BY `position`
0.365 ms 1 Yes /classes/Product.php:3545
112
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.363 ms 1 /classes/stock/StockAvailable.php:453
205
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23358
ORDER BY f.position ASC
0.363 ms 4 Yes /classes/Product.php:6015
445
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23537) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
6
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
49
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_accounts" LIMIT 1
0.358 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
339
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.356 ms 1 /classes/stock/StockAvailable.php:806
164
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23354)
0.355 ms 1 /classes/Product.php:3860
527
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 10 LIMIT 1
0.353 ms 1 /classes/Country.php:252
115
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23348
AND image_shop.`cover` = 1 LIMIT 1
0.351 ms 1 /classes/Product.php:3570
295
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23728
AND image_shop.`cover` = 1 LIMIT 1
0.351 ms 1 /classes/Product.php:3570
208
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23534) AND (b.`id_shop` = 1) LIMIT 1
0.348 ms 1 /src/Adapter/EntityMapper.php:71
462
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23582 AND `id_shop` = 1
0.348 ms 1 /src/Adapter/EntityMapper.php:79
301
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23728 AND `id_group` = 1 LIMIT 1
0.343 ms 0 /classes/GroupReduction.php:156
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `uag_lang` l
JOIN uag_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.342 ms 1 /classes/Language.php:1216
64
SELECT SQL_NO_CACHE *
FROM `uag_category` a0
LEFT JOIN `uag_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 134) AND (a0.`nright` > 135) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.342 ms 69 /classes/PrestaShopCollection.php:383
144
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23351 LIMIT 1
0.342 ms 1 /classes/SpecificPrice.php:435
270
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23583 AND id_shop=1 LIMIT 1
0.341 ms 1 /classes/Product.php:6870
396
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23356) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM uag_shop_url su
LEFT JOIN uag_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.angoloufficio.it' OR su.domain_ssl = 'www.angoloufficio.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.336 ms 1 Yes /classes/shop/Shop.php:1364
117
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23348 LIMIT 1
0.334 ms 1 /classes/SpecificPrice.php:435
404
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23357) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
167
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.333 ms 1 /classes/stock/StockAvailable.php:453
437
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23536) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
887
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:20:27" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:20:27" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69483, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.331 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
239
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23537)
0.329 ms 1 /classes/Product.php:3860
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `uag_hook_alias`
0.327 ms 88 /classes/Hook.php:287
88
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23345
AND image_shop.`cover` = 1 LIMIT 1
0.324 ms 1 /classes/Product.php:3570
53
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.323 ms 3 /classes/CartRule.php:357
365
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23351 AND `id_shop` = 1
0.323 ms 1 /src/Adapter/EntityMapper.php:79
896
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.323 ms 0 /classes/tax/TaxRulesTaxManager.php:109
145
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23351)
0.320 ms 1 /classes/Product.php:3860
136
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23350)
0.318 ms 1 /classes/Product.php:3860
188
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23357
AND image_shop.`cover` = 1 LIMIT 1
0.318 ms 1 /classes/Product.php:3570
245
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23538
AND image_shop.`cover` = 1 LIMIT 1
0.317 ms 1 /classes/Product.php:3570
259
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23582)
0.317 ms 1 /classes/Product.php:3860
496
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23728
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.317 ms 0 /classes/Product.php:1732
388
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23355) LIMIT 1
0.316 ms 1 /src/Adapter/EntityMapper.php:71
176
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.315 ms 1 /classes/stock/StockAvailable.php:453
106
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23347
AND image_shop.`cover` = 1 LIMIT 1
0.314 ms 1 /classes/Product.php:3570
537
SELECT SQL_NO_CACHE `name`
FROM `uag_hook`
WHERE `id_hook` = 1003 LIMIT 1
0.313 ms 1 /classes/Hook.php:244
219
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23535)
0.312 ms 1 /classes/Product.php:3860
477
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23584) LIMIT 1
0.312 ms 1 /src/Adapter/EntityMapper.php:71
74
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23344)
0.310 ms 1 /classes/Product.php:3860
486
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23727 AND `id_shop` = 1
0.310 ms 1 /src/Adapter/EntityMapper.php:79
275
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23584
AND image_shop.`cover` = 1 LIMIT 1
0.308 ms 1 /classes/Product.php:3570
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23358
AND image_shop.`cover` = 1 LIMIT 1
0.306 ms 1 /classes/Product.php:3570
119
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23348 AND id_shop=1 LIMIT 1
0.304 ms 1 /classes/Product.php:6870
453
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23538) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
914
SELECT SQL_NO_CACHE *
FROM `uag_cms` a
LEFT JOIN `uag_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `uag_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) AND (b.`id_shop` = 1) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
298
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23728 LIMIT 1
0.303 ms 1 /classes/SpecificPrice.php:435
319
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23345 LIMIT 1
0.300 ms 1 /classes/Product.php:1106
540
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 8086
AND `id_shop` = 1 LIMIT 1
0.299 ms 1 /classes/Category.php:2450
190
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23357 LIMIT 1
0.298 ms 1 /classes/SpecificPrice.php:435
366
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23351
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.297 ms 0 /classes/Product.php:1732
429
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23535) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
289
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23727)
0.296 ms 1 /classes/Product.php:3860
544
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8086) LIMIT 1
0.296 ms 1 /src/Adapter/EntityMapper.php:71
834
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.296 ms 1 /classes/Category.php:2242
490
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23727
0.295 ms 1 /classes/Tag.php:244
216
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23535
AND image_shop.`cover` = 1 LIMIT 1
0.294 ms 1 /classes/Product.php:3570
248
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23538 LIMIT 1
0.292 ms 1 /classes/SpecificPrice.php:435
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM uag_shop s
LEFT JOIN uag_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.290 ms 1 /classes/shop/Shop.php:218
55
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.290 ms 0 /classes/module/Module.php:2636
262
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23582) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:453
463
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23582
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.289 ms 0 /classes/Product.php:1732
892
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23538)
GROUP BY a0.`id_supplier`
0.284 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
52
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.283 ms 3 /classes/CartRule.php:423
497
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23728 LIMIT 1
0.283 ms 1 /classes/Product.php:1106
374
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23352
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.282 ms 0 /classes/Product.php:1732
367
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23351 LIMIT 1
0.281 ms 1 /classes/Product.php:1106
160
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23354
AND image_shop.`cover` = 1 LIMIT 1
0.280 ms 1 /classes/Product.php:3570
899
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23538 LIMIT 1
0.279 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
22
SELECT SQL_NO_CACHE DISTINCT g.`id_group`, g.`reduction`, g.`price_display_method`, g.`show_prices`, gl.`name`
FROM `uag_group` g
LEFT JOIN `uag_group_lang` AS gl ON (g.`id_group` = gl.`id_group` AND gl.`id_lang` = 1)
ORDER BY g.`id_group` ASC
0.277 ms 6 Yes /classes/Group.php:111
54
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.277 ms 1 /classes/CartRule.php:423
488
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23727
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.276 ms 0 /classes/Product.php:1732
911
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 3) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.275 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM uag_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.274 ms 1 /classes/shop/ShopUrl.php:182
873
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.273 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
258
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23582 LIMIT 1
0.272 ms 1 /classes/SpecificPrice.php:435
495
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23728 AND `id_shop` = 1
0.271 ms 1 /src/Adapter/EntityMapper.php:79
334
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23347
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.270 ms 0 /classes/Product.php:1732
288
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23727 LIMIT 1
0.269 ms 1 /classes/SpecificPrice.php:435
909
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 1) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.269 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
255
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23582
AND image_shop.`cover` = 1 LIMIT 1
0.268 ms 1 /classes/Product.php:3570
97
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23346
AND image_shop.`cover` = 1 LIMIT 1
0.266 ms 1 /classes/Product.php:3570
333
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23347 AND `id_shop` = 1
0.264 ms 1 /src/Adapter/EntityMapper.php:79
489
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23727 LIMIT 1
0.263 ms 1 /classes/Product.php:1106
529
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.263 ms 1 /classes/Country.php:194
870
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.262 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
3
SELECT SQL_NO_CACHE *
FROM `uag_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.261 ms 1 /src/Adapter/EntityMapper.php:71
327
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23346 LIMIT 1
0.260 ms 1 /classes/Product.php:1106
498
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23728
0.259 ms 1 /classes/Tag.php:244
326
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23346
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.259 ms 0 /classes/Product.php:1732
198
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.258 ms 1 /classes/Product.php:5655
127
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23349)
0.257 ms 1 /classes/Product.php:3860
470
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23583 AND `id_shop` = 1
0.257 ms 1 /src/Adapter/EntityMapper.php:79
256
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.256 ms 1 /classes/Product.php:5655
351
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23349 LIMIT 1
0.253 ms 1 /classes/Product.php:1106
508
UPDATE `uag_ybc_blog_post` SET enabled=1,datetime_added="2024-05-08 14:20:26",datetime_modified="2024-05-08 14:20:26" WHERE datetime_active!="0000-00-00" AND datetime_active is not NULL AND enabled=2 AND datetime_active<=NOW()
0.253 ms 1 /modules/ybc_blog/classes/ybc_blog_post_class.php:622
100
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23346)
0.252 ms 1 /classes/Product.php:3860
118
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23348)
0.252 ms 1 /classes/Product.php:3860
350
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23349
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.252 ms 0 /classes/Product.php:1732
341
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23348 AND `id_shop` = 1
0.251 ms 1 /src/Adapter/EntityMapper.php:79
370
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.251 ms 1 /classes/stock/StockAvailable.php:753
382
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23354
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.251 ms 0 /classes/Product.php:1732
336
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23347
0.251 ms 1 /classes/Tag.php:244
918
SELECT SQL_NO_CACHE `id_page`
FROM `uag_page`
WHERE `id_page_type` = 7 AND `id_object` = 8086 LIMIT 1
0.249 ms 1 /classes/Page.php:83
413
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23358 AND `id_shop` = 1
0.249 ms 1 /src/Adapter/EntityMapper.php:79
361
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.248 ms 1 /classes/stock/StockAvailable.php:778
318
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23345
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.248 ms 0 /classes/Product.php:1732
423
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23534
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.248 ms 0 /classes/Product.php:1732
193
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23357 AND `id_group` = 1 LIMIT 1
0.247 ms 0 /classes/GroupReduction.php:156
482
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.247 ms 1 /classes/stock/StockAvailable.php:778
502
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund` gf
WHERE (gf.shop_id=1) AND (gf.sent= "0") LIMIT 1
0.246 ms 1 /modules/ganalyticspro/models/orderRefund.php:105
500
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:753
835
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
861
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.245 ms 1 /classes/module/Module.php:2109
457
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23538
0.244 ms 1 /classes/Tag.php:244
510
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenterpro" LIMIT 1
0.244 ms 1 /classes/module/Module.php:2636
84
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
103
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.244 ms 1 /classes/stock/StockAvailable.php:453
384
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23354
0.243 ms 1 /classes/Tag.php:244
94
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.242 ms 1 /classes/stock/StockAvailable.php:453
447
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23537
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.242 ms 0 /classes/Product.php:1732
501
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.241 ms 1 /classes/stock/StockAvailable.php:806
414
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23358
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.240 ms 0 /classes/Product.php:1732
456
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23538 LIMIT 1
0.240 ms 1 /classes/Product.php:1106
151
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23352
AND image_shop.`cover` = 1 LIMIT 1
0.240 ms 1 /classes/Product.php:3570
161
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.239 ms 1 /classes/Product.php:5655
369
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:778
218
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23535 LIMIT 1
0.238 ms 1 /classes/SpecificPrice.php:435
352
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23349
0.238 ms 1 /classes/Tag.php:244
342
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23348
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.237 ms 0 /classes/Product.php:1732
479
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23584
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.237 ms 0 /classes/Product.php:1732
101
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23346 AND id_shop=1 LIMIT 1
0.236 ms 1 /classes/Product.php:6870
310
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23344 LIMIT 1
0.236 ms 1 /classes/Product.php:1106
354
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:753
876
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.236 ms 1 /classes/module/Module.php:2636
229
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23536)
0.234 ms 1 /classes/Product.php:3860
853
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `uag_currency` c
LEFT JOIN uag_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.234 ms 1 /classes/Currency.php:1136
492
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:753
7
SELECT SQL_NO_CACHE *
FROM `uag_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.232 ms 1 /src/Adapter/EntityMapper.php:71
185
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
533
SELECT SQL_NO_CACHE id_module as id, active FROM uag_module WHERE name = "gmerchantcenterpro" AND active = 1
0.232 ms 1 /modules/gremarketing/lib/moduleTools.php:398
906
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.232 ms 1 /classes/module/Module.php:2636
171
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.231 ms 1 /classes/Product.php:5655
416
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23358
0.231 ms 1 /classes/Tag.php:244
900
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23538)
GROUP BY a0.`id_supplier`
0.230 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
203
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.229 ms 1 /classes/stock/StockAvailable.php:453
266
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.228 ms 1 /classes/Product.php:5655
302
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23728) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.228 ms 1 /classes/stock/StockAvailable.php:453
154
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23352)
0.228 ms 1 /classes/Product.php:3860
311
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23344
0.228 ms 1 /classes/Tag.php:244
421
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23534 AND `id_shop` = 1
0.227 ms 1 /src/Adapter/EntityMapper.php:79
180
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.226 ms 1 /classes/Product.php:5655
181
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23356 LIMIT 1
0.226 ms 1 /classes/SpecificPrice.php:435
400
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23356
0.226 ms 1 /classes/Tag.php:244
446
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23537 AND `id_shop` = 1
0.226 ms 1 /src/Adapter/EntityMapper.php:79
872
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.226 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
449
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23537
0.225 ms 1 /classes/Tag.php:244
503
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund_partial` grf
WHERE (grf.shop_id=1) AND (grf.sent= "0") LIMIT 1
0.225 ms 1 /modules/ganalyticspro/models/orderPartialRefund.php:105
415
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23358 LIMIT 1
0.225 ms 1 /classes/Product.php:1106
480
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23584 LIMIT 1
0.225 ms 1 /classes/Product.php:1106
242
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.224 ms 1 /classes/stock/StockAvailable.php:453
296
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.223 ms 1 /classes/Product.php:5655
530
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.223 ms 1 /classes/Country.php:252
143
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.223 ms 1 /classes/Product.php:5655
172
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23355 LIMIT 1
0.223 ms 1 /classes/SpecificPrice.php:435
406
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23357
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.223 ms 0 /classes/Product.php:1732
491
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.222 ms 1 /classes/stock/StockAvailable.php:778
31
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.221 ms 1 /modules/ps_mbo/ps_mbo.php:335
478
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23584 AND `id_shop` = 1
0.221 ms 1 /src/Adapter/EntityMapper.php:79
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
320
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23345
0.220 ms 1 /classes/Tag.php:244
871
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715170827
0.220 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
483
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:753
312
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:778
343
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23348 LIMIT 1
0.217 ms 1 /classes/Product.php:1106
8
SELECT SQL_NO_CACHE *
FROM `uag_lang` a
LEFT JOIN `uag_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.217 ms 1 /src/Adapter/EntityMapper.php:71
192
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23357 AND id_shop=1 LIMIT 1
0.216 ms 1 /classes/Product.php:6870
397
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23356 AND `id_shop` = 1
0.216 ms 1 /src/Adapter/EntityMapper.php:79
473
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23583
0.216 ms 1 /classes/Tag.php:244
897
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23538 AND `id_group` = 0 LIMIT 1
0.216 ms 0 /classes/GroupReduction.php:156
487
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 59955
AND `active` = 1 LIMIT 1
0.215 ms 1 /classes/Manufacturer.php:316
389
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23355 AND `id_shop` = 1
0.215 ms 1 /src/Adapter/EntityMapper.php:79
292
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:453
329
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:778
353
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:778
454
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23538 AND `id_shop` = 1
0.214 ms 1 /src/Adapter/EntityMapper.php:79
108
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23347 LIMIT 1
0.214 ms 1 /classes/SpecificPrice.php:435
232
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.213 ms 1 /classes/stock/StockAvailable.php:453
29
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.212 ms 1 /modules/ps_mbo/ps_mbo.php:335
282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:453
442
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:778
399
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23356 LIMIT 1
0.211 ms 1 /classes/Product.php:1106
466
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23582) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.211 ms 1 /classes/stock/StockAvailable.php:778
505
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ybc_blog" LIMIT 1
0.211 ms 1 /classes/module/Module.php:2636
513
SELECT SQL_NO_CACHE * FROM `uag_image_type`
0.211 ms 8 /classes/ImageType.php:161
75
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23344 AND id_shop=1 LIMIT 1
0.210 ms 1 /classes/Product.php:6870
869
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.210 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
383
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23354 LIMIT 1
0.209 ms 1 /classes/Product.php:1106
910
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 2) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.209 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
523
SELECT SQL_NO_CACHE id_feed
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.208 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:75
201
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23358 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6870
371
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.208 ms 1 /classes/stock/StockAvailable.php:806
438
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23536 AND `id_shop` = 1
0.208 ms 1 /src/Adapter/EntityMapper.php:79
889
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 23538
0.208 ms 4 /override/classes/Product.php:24
891
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23538 LIMIT 1
0.208 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
913
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 5) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.208 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
484
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23584) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.207 ms 1 /classes/stock/StockAvailable.php:806
189
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.206 ms 1 /classes/Product.php:5655
206
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23534
AND image_shop.`cover` = 1 LIMIT 1
0.206 ms 1 /classes/Product.php:3570
183
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23356 AND id_shop=1 LIMIT 1
0.205 ms 1 /classes/Product.php:6870
465
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23582
0.205 ms 1 /classes/Tag.php:244
898
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 0 LIMIT 1
0.205 ms 0 /classes/Group.php:154
236
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.204 ms 1 /classes/Product.php:5655
912
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 4) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.204 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
424
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23534 LIMIT 1
0.203 ms 1 /classes/Product.php:1106
92
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23345 AND id_shop=1 LIMIT 1
0.203 ms 1 /classes/Product.php:6870
538
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "payplug" LIMIT 1
0.203 ms 1 /classes/module/Module.php:2636
325
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23346 AND `id_shop` = 1
0.202 ms 1 /src/Adapter/EntityMapper.php:79
880
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c LEFT JOIN uag_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 8086 AND s.id_shop = 1 LIMIT 1
0.202 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
362
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:753
28
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.201 ms 1 /modules/ps_mbo/ps_mbo.php:325
35
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.201 ms 1 /classes/Language.php:883
519
CREATE TABLE IF NOT EXISTS `uag_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.201 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
137
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23350 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6870
535
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenter" LIMIT 1
0.199 ms 0 /classes/module/Module.php:2636
398
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23356
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.199 ms 0 /classes/Product.php:1732
418
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:753
199
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23358 LIMIT 1
0.198 ms 1 /classes/SpecificPrice.php:435
330
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:753
506
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 120 AND `id_shop` = 1 LIMIT 1
0.198 ms 1 /classes/module/Module.php:2109
331
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:806
337
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:778
903
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.197 ms 1 /classes/module/Module.php:2636
471
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23583
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.196 ms 0 /classes/Product.php:1732
60
SELECT SQL_NO_CACHE *
FROM `uag_state` a
WHERE (a.`id_state` = 234) LIMIT 1
0.196 ms 1 /src/Adapter/EntityMapper.php:71
61
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.196 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 10
0.196 ms 1 /src/Adapter/EntityMapper.php:79
121
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
468
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23582) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:806
467
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23582) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:753
888
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 23538
0.194 ms 3 /classes/Product.php:3423
917
SELECT SQL_NO_CACHE id_page_type
FROM uag_page_type
WHERE name = 'category' LIMIT 1
0.194 ms 1 /classes/Page.php:104
368
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23351
0.193 ms 1 /classes/Tag.php:244
165
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23354 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6870
240
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23537 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6870
306
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23344 AND `id_shop` = 1
0.193 ms 1 /src/Adapter/EntityMapper.php:79
534
SELECT SQL_NO_CACHE * FROM uag_module_shop WHERE id_module = 109 AND id_shop = 1
0.193 ms 1 /modules/gremarketing/lib/moduleTools.php:403
408
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23357
0.192 ms 1 /classes/Tag.php:244
493
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23727) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:806
174
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23355 AND id_shop=1 LIMIT 1
0.192 ms 1 /classes/Product.php:6870
409
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.191 ms 1 /classes/stock/StockAvailable.php:778
338
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.191 ms 1 /classes/stock/StockAvailable.php:753
129
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23349 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
241
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23537 AND `id_group` = 1 LIMIT 1
0.190 ms 0 /classes/GroupReduction.php:156
419
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.190 ms 1 /classes/stock/StockAvailable.php:806
516
CREATE TABLE IF NOT EXISTS `uag_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.190 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
511
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.190 ms 0 /classes/module/Module.php:2636
36
SELECT SQL_NO_CACHE value FROM `uag_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.189 ms 1 /classes/shop/Shop.php:1183
407
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23357 LIMIT 1
0.187 ms 1 /classes/Product.php:1106
426
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.187 ms 1 /classes/stock/StockAvailable.php:778
184
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23356 AND `id_group` = 1 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
851
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.187 ms 1 /classes/module/Module.php:2636
30
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.186 ms 1 /modules/ps_mbo/ps_mbo.php:325
120
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23348 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
166
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23354 AND `id_group` = 1 LIMIT 1
0.186 ms 0 /classes/GroupReduction.php:156
392
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23355
0.186 ms 1 /classes/Tag.php:244
455
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23538
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.186 ms 0 /classes/Product.php:1732
848
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 8086 LIMIT 1
0.186 ms 1 /classes/Category.php:1585
83
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.185 ms 0 /classes/tax/TaxRulesTaxManager.php:109
202
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23358 AND `id_group` = 1 LIMIT 1
0.185 ms 0 /classes/GroupReduction.php:156
213
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:453
385
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:778
545
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8086 AND `id_shop` = 1
0.185 ms 1 /src/Adapter/EntityMapper.php:79
881
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitreviews" LIMIT 1
0.184 ms 1 /classes/module/Module.php:2636
146
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23351 AND id_shop=1 LIMIT 1
0.183 ms 1 /classes/Product.php:6870
175
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23355 AND `id_group` = 1 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
405
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23357 AND `id_shop` = 1
0.183 ms 1 /src/Adapter/EntityMapper.php:79
315
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8086 LIMIT 1
0.182 ms 0 /classes/Category.php:1378
431
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23535
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.182 ms 0 /classes/Product.php:1732
134
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.181 ms 1 /classes/Product.php:5655
390
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23355
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.181 ms 0 /classes/Product.php:1732
450
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:778
81
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23344 AND `id_group` = 1 LIMIT 1
0.180 ms 0 /classes/GroupReduction.php:156
439
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23536
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.180 ms 0 /classes/Product.php:1732
148
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:453
152
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.179 ms 1 /classes/Product.php:5655
886
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23538)
GROUP BY a0.`id_supplier`
0.179 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
393
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:778
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `uag_lang` l
LEFT JOIN `uag_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.177 ms 1 /classes/Language.php:1080
128
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23349 AND id_shop=1 LIMIT 1
0.177 ms 1 /classes/Product.php:6870
80
SELECT SQL_NO_CACHE *
FROM `uag_tax_lang`
WHERE `id_tax` = 1
0.176 ms 1 /src/Adapter/EntityMapper.php:79
40
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
110
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23347 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6870
222
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.172 ms 1 /classes/stock/StockAvailable.php:453
458
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.172 ms 1 /classes/stock/StockAvailable.php:778
290
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23727 AND id_shop=1 LIMIT 1
0.171 ms 1 /classes/Product.php:6870
130
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.171 ms 1 /classes/stock/StockAvailable.php:453
890
SELECT SQL_NO_CACHE `id_zone`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.171 ms 1 /classes/Country.php:224
111
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23347 AND `id_group` = 1 LIMIT 1
0.169 ms 0 /classes/GroupReduction.php:156
512
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.169 ms 0 /classes/module/Module.php:2636
207
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.168 ms 1 /classes/Product.php:5655
441
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23536
0.168 ms 1 /classes/Tag.php:244
212
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23534 AND `id_group` = 1 LIMIT 1
0.168 ms 0 /classes/GroupReduction.php:156
433
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23535
0.167 ms 1 /classes/Tag.php:244
907
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.167 ms 1 /classes/module/Module.php:2109
344
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23348
0.167 ms 1 /classes/Tag.php:244
276
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.166 ms 1 /classes/Product.php:5655
313
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:753
432
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23535 LIMIT 1
0.166 ms 1 /classes/Product.php:1106
428
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.165 ms 1 /classes/stock/StockAvailable.php:806
474
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23583) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.165 ms 1 /classes/stock/StockAvailable.php:778
520
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.165 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
89
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.164 ms 1 /classes/Product.php:5655
90
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23345 LIMIT 1
0.164 ms 1 /classes/SpecificPrice.php:435
260
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23582 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6870
261
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23582 AND `id_group` = 1 LIMIT 1
0.164 ms 0 /classes/GroupReduction.php:156
440
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23536 LIMIT 1
0.164 ms 1 /classes/Product.php:1106
43
SELECT SQL_NO_CACHE *
FROM `uag_group` a
LEFT JOIN `uag_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.163 ms 1 /src/Adapter/EntityMapper.php:71
47
SELECT SQL_NO_CACHE ctg.`id_group`
FROM uag_category_group ctg
WHERE ctg.`id_category` = 8086 AND ctg.`id_group` = 1 LIMIT 1
0.162 ms 1 /classes/Category.php:1754
231
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23536 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
157
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.161 ms 1 /classes/stock/StockAvailable.php:453
345
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.161 ms 1 /classes/stock/StockAvailable.php:778
833
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c WHERE c.id_category = 8086 LIMIT 1
0.160 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
877
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.160 ms 1 /classes/module/Module.php:2109
391
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23355 LIMIT 1
0.159 ms 1 /classes/Product.php:1106
448
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23537 LIMIT 1
0.159 ms 1 /classes/Product.php:1106
472
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23583 LIMIT 1
0.159 ms 1 /classes/Product.php:1106
476
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23583) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.157 ms 1 /classes/stock/StockAvailable.php:806
116
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.156 ms 1 /classes/Product.php:5655
430
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23535 AND `id_shop` = 1
0.156 ms 1 /src/Adapter/EntityMapper.php:79
435
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.156 ms 1 /classes/stock/StockAvailable.php:753
883
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 23538 LIMIT 1
0.156 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
9
SELECT SQL_NO_CACHE id_shop
FROM `uag_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.155 ms 1 /classes/ObjectModel.php:1729
99
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23346 LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:435
425
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23534
0.155 ms 1 /classes/Tag.php:244
904
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.155 ms 1 /classes/module/Module.php:2109
386
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.154 ms 1 /classes/stock/StockAvailable.php:753
858
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.154 ms 1 /classes/module/Module.php:2636
417
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:778
125
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.153 ms 1 /classes/Product.php:5655
452
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:806
885
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23538 LIMIT 1
0.152 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
72
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 0 LIMIT 1
0.152 ms 1 /classes/SpecificPrice.php:426
209
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23534 LIMIT 1
0.152 ms 1 /classes/SpecificPrice.php:435
252
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:453
401
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:778
451
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23537) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:753
882
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1
0.152 ms 1 /classes/module/Module.php:2109
37
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.151 ms 1 /classes/Currency.php:893
246
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.151 ms 1 /classes/Product.php:5655
517
CREATE TABLE IF NOT EXISTS `uag_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.150 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
228
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23536 LIMIT 1
0.150 ms 1 /classes/SpecificPrice.php:435
251
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23538 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
291
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23727 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
308
SELECT SQL_NO_CACHE `name` FROM `uag_supplier` WHERE `id_supplier` = 0 LIMIT 1
0.149 ms 0 /classes/Supplier.php:243
347
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:806
411
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:806
79
SELECT SQL_NO_CACHE *
FROM `uag_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.147 ms 1 /src/Adapter/EntityMapper.php:71
314
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.147 ms 1 /classes/stock/StockAvailable.php:806
355
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.147 ms 1 /classes/stock/StockAvailable.php:806
93
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23345 AND `id_group` = 1 LIMIT 1
0.145 ms 0 /classes/GroupReduction.php:156
840
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.145 ms 1 /src/Adapter/EntityMapper.php:71
403
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:806
46
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 8086
AND `id_shop` = 1 LIMIT 1
0.143 ms 1 /classes/Category.php:2450
71
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.143 ms 1 /classes/Product.php:5655
394
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:753
836
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 8086 LIMIT 1
0.143 ms 1 /classes/Category.php:1585
866
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.143 ms 1 /classes/module/Module.php:2636
346
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:753
521
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.142 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
70
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8086 LIMIT 1
0.142 ms 1 /classes/Category.php:1378
436
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:806
518
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.142 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
230
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23536 AND id_shop=1 LIMIT 1
0.141 ms 1 /classes/Product.php:6870
444
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
422
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 69483
AND `active` = 1 LIMIT 1
0.138 ms 1 /classes/Manufacturer.php:316
402
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.137 ms 1 /classes/stock/StockAvailable.php:753
874
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.137 ms 1 /classes/module/Module.php:2636
147
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23351 AND `id_group` = 1 LIMIT 1
0.137 ms 0 /classes/GroupReduction.php:156
321
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:778
220
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23535 AND id_shop=1 LIMIT 1
0.134 ms 1 /classes/Product.php:6870
854
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.134 ms 1 /classes/module/Module.php:2636
831
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 23538
0.133 ms 1 /classes/Product.php:2902
395
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:806
859
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.132 ms 1 /classes/module/Module.php:2109
63
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM uag_required_field
0.131 ms 1 /classes/ObjectModel.php:1592
410
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:753
868
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715170827
0.131 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
73
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23344 LIMIT 1
0.130 ms 1 /classes/SpecificPrice.php:435
864
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitsearch" LIMIT 1
0.130 ms 1 /classes/module/Module.php:2636
44
SELECT SQL_NO_CACHE *
FROM `uag_group_lang`
WHERE `id_group` = 1
0.129 ms 1 /src/Adapter/EntityMapper.php:79
98
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.129 ms 1 /classes/Product.php:5655
539
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 130 AND `id_shop` = 1 LIMIT 1
0.128 ms 1 /classes/module/Module.php:2109
862
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcompare" LIMIT 1
0.128 ms 1 /classes/module/Module.php:2636
839
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 23538) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.127 ms 1 /classes/Product.php:7720
156
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23352 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
844
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7842) LIMIT 1
0.124 ms 1 /src/Adapter/EntityMapper.php:71
843
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7878 AND `id_shop` = 1
0.122 ms 1 /src/Adapter/EntityMapper.php:79
878
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitelementor" LIMIT 1
0.122 ms 1 /classes/module/Module.php:2636
856
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.121 ms 1 /classes/module/Module.php:2636
443
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23536) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.120 ms 1 /classes/stock/StockAvailable.php:753
841
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.120 ms 1 /src/Adapter/EntityMapper.php:79
846
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 3) LIMIT 1
0.118 ms 1 /src/Adapter/EntityMapper.php:71
59
SELECT SQL_NO_CACHE `need_identification_number`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.117 ms 1 /classes/Country.php:405
126
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23349 LIMIT 1
0.117 ms 1 /classes/SpecificPrice.php:435
221
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23535 AND `id_group` = 1 LIMIT 1
0.117 ms 0 /classes/GroupReduction.php:156
845
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7842 AND `id_shop` = 1
0.116 ms 1 /src/Adapter/EntityMapper.php:79
849
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.116 ms 1 /classes/Category.php:1591
459
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.116 ms 1 /classes/stock/StockAvailable.php:753
863
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.116 ms 1 /classes/module/Module.php:2109
514
BEGIN
0.114 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:74
832
SELECT SQL_NO_CACHE state FROM uag_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.113 ms 1 /classes/FeatureFlag.php:105
852
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.113 ms 1 /classes/module/Module.php:2109
857
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.112 ms 1 /classes/module/Module.php:2109
82
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 1 LIMIT 1
0.111 ms 1 /classes/Group.php:154
39
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.109 ms 1 /classes/Language.php:883
56
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.109 ms 0 /classes/module/Module.php:2109
434
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23535) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.109 ms 1 /classes/stock/StockAvailable.php:778
58
SELECT SQL_NO_CACHE format
FROM `uag_address_format`
WHERE `id_country` = 10 LIMIT 1
0.108 ms 1 /classes/AddressFormat.php:656
842
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7878) LIMIT 1
0.108 ms 1 /src/Adapter/EntityMapper.php:71
847
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 3 AND `id_shop` = 1
0.108 ms 1 /src/Adapter/EntityMapper.php:79
41
SELECT SQL_NO_CACHE *
FROM `uag_currency_lang`
WHERE `id_currency` = 1
0.105 ms 1 /src/Adapter/EntityMapper.php:79
855
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.104 ms 1 /classes/module/Module.php:2109
860
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.104 ms 1 /classes/module/Module.php:2636
322
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.102 ms 1 /classes/stock/StockAvailable.php:753
427
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23534) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.102 ms 1 /classes/stock/StockAvailable.php:753
865
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.102 ms 1 /classes/module/Module.php:2109
45
SELECT SQL_NO_CACHE id_shop
FROM `uag_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.100 ms 1 /classes/ObjectModel.php:1729
155
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23352 AND id_shop=1 LIMIT 1
0.099 ms 1 /classes/Product.php:6870
307
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 40434
AND `active` = 1 LIMIT 1
0.099 ms 1 /classes/Manufacturer.php:316
879
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.097 ms 1 /classes/module/Module.php:2109
460
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23538) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.094 ms 1 /classes/stock/StockAvailable.php:806
875
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1
0.086 ms 1 /classes/module/Module.php:2109
387
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.084 ms 1 /classes/stock/StockAvailable.php:806
42
SELECT SQL_NO_CACHE id_shop
FROM `uag_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.082 ms 1 /classes/ObjectModel.php:1729
867
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 8 AND `id_shop` = 1 LIMIT 1
0.078 ms 1 /classes/module/Module.php:2109
837
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.072 ms 1 /classes/Category.php:1591

Doubles

266 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=XX)) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value=XX)) GROUP BY fp.id_feature_value
25 queries
SELECT XX FROM `uag_specific_price` WHERE id_product = XX LIMIT XX
25 queries
			SELECT `reduction`
			FROM `uag_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
24 queries
SELECT image_shop.`id_image`
                    FROM `uag_image` i
                     INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
24 queries
SELECT name FROM uag_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
24 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
24 queries
                            SELECT `id_tax_rules_group`
                            FROM `uag_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
24 queries
SELECT SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `uag_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
24 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM uag_feature_product pf
                LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN uag_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
24 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
24 queries
SELECT *
							FROM `uag_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
24 queries
SELECT COUNT(p.id_product)
            FROM `uag_product` p
             INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
            WHERE p.id_product = XX
            AND DATEDIFF("XX-XX-XX XX:XX:XX", product_shop.`date_add`) < XX LIMIT XX
24 queries
SELECT product_attribute_shop.id_product_attribute
                FROM uag_product_attribute pa
                 INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
        SELECT t.`id_lang`, t.`name`
        FROM uag_tag t
        LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
        WHERE pt.`id_product`=XX
24 queries
SELECT out_of_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
17 queries
SELECT `id_module` FROM `uag_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
10 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
6 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `uag_module` m
                LEFT JOIN `uag_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
5 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
5 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
5 queries
SELECT *
							FROM `uag_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
5 queries
SELECT a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = XX)
WHERE (a.`id_lgcookieslaw_purpose` = XX) AND (a.`id_shop` = XX) AND (a.`active` = XX)
ORDER BY a.`name`
4 queries
				SELECT tr.*
				FROM `uag_tax_rule` tr
				JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
3 queries
				SELECT `name`
				FROM `uag_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries
SELECT id_manufacturer FROM `uag_product` WHERE id_product = XX LIMIT XX
3 queries
SELECT *
FROM `uag_product_supplier` aXX
WHERE (aXX.`id_product` = XX)
GROUP BY aXX.`id_supplier`
3 queries
                 SELECT gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "XX-XX-XX XX:XX:XX" OR date_from = "XX-XX-XX XX:XX:XX") AND (date_to >= "XX-XX-XX XX:XX:XX" OR date_to = "XX-XX-XX XX:XX:XX") AND gi.`id_shop` = XX AND gi.`active` = XX  AND (gi.groups = ""  OR FIND_IN_SET(XX, REPLACE(gi.groups, ";", ",")) > XX) AND (gi.manufacturers = "" OR FIND_IN_SET(XX, REPLACE(gi.manufacturers, ";", ",")) > XX) AND (gi.suppliers = "" ) ORDER BY position, priority
2 queries
SELECT s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = XX
 INNER JOIN uag_supplier_shop supplier_shop
        ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = XX)
WHERE (s.`active` = XX)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
2 queries
SELECT `active`
        FROM `uag_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT m.`id_module` as `active`, ms.`id_module` as `shop_active`
        FROM `uag_module` m
        LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
2 queries
SELECT `id_lang` FROM `uag_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `uag_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `uag_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `uag_country_lang`
							WHERE `id_country` = XX
2 queries
SELECT a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = XX)
WHERE (a.`id_shop` = XX) AND (a.`active` = XX)
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, XX) AS id_product_attribute,
					product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
					pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
					il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
					DATEDIFF(product_shop.`date_add`, DATE_SUB("XX-XX-XX XX:XX:XX",
					INTERVAL XX DAY)) > XX AS new, product_shop.price AS orderprice
				FROM `uag_category_product` cp
				LEFT JOIN `uag_product` p
					ON p.`id_product` = cp.`id_product`
				 INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
				ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = XX AND product_attribute_shop.id_shop=XX)
				 LEFT JOIN uag_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = XX AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
				LEFT JOIN `uag_category_lang` cl
					ON (product_shop.`id_category_default` = cl.`id_category`
					AND cl.`id_lang` = XX AND cl.id_shop = XX )
				LEFT JOIN `uag_product_lang` pl
					ON (p.`id_product` = pl.`id_product`
					AND pl.`id_lang` = XX AND pl.id_shop = XX )
				LEFT JOIN `uag_image_shop` image_shop
					ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=XX AND image_shop.id_shop=XX)
				LEFT JOIN `uag_image_lang` il
					ON (image_shop.`id_image` = il.`id_image`
					AND il.`id_lang` = XX)
				LEFT JOIN `uag_manufacturer` m
					ON m.`id_manufacturer` = p.`id_manufacturer`
				WHERE product_shop.`id_shop` = XX
					AND cp.`id_category` = XX AND product_shop.`active` = XX AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
			LIMIT XX,XX
2 queries
			SELECT cl.`link_rewrite`
			FROM `uag_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
2 queries
			SELECT `reduction`
			FROM `uag_group`
			WHERE `id_group` = XX LIMIT XX
2 queries
							SELECT `name`
							FROM `uag_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright`  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright` FROM `uag_category` c
            WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.*, cl.*  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
2 queries
DELETE FROM `uag_feedaty_cache` WHERE expiration < XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_widgets" LIMIT XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_analytics" LIMIT XX

Tables stress

838 feature_product
388 product
385 product_shop
377 stock_available
303 product_attribute
294 category
280 category_product
279 category_group
278 product_attribute_combination
274 product_sale
51 product_attribute_shop
49 cart_product
44 category_lang
38 product_lang
36 module
29 feature_value_lang
27 module_shop
27 image_shop
26 feature
26 feature_shop
26 feature_lang
25 image
25 specific_price
25 product_group_reduction_cache
24 pack
24 tag
24 product_tag
12 category_shop
7 country
7 hook
6 currency
6 manufacturer
6 feature_value
6 feedaty_cache
5 lang
5 country_lang
5 group
5 layered_indexable_feature_value_lang_value
5 lgcookieslaw_cookie
5 lgcookieslaw_cookie_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 tax_rule
4 tax_rules_group
4 multipleprices_configuration
3 country_shop
3 hook_alias
3 supplier
3 group_lang
3 group_shop
3 image_lang
3 gmcp_feeds
3 product_supplier
2 shop_group
2 configuration
2 hook_module
2 supplier_lang
2 supplier_shop
2 currency_lang
2 cart_rule_lang
2 image_type
2 lgcookieslaw_purpose
2 lgcookieslaw_purpose_lang
2 iqit_elementor_category
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 revslider_sliders
1 tax
1 tax_lang
1 gap_refund
1 gap_refund_partial
1 ets_abancart_campaign
1 ets_abancart_campaign_country
1 ets_abancart_campaign_with_lang
1 ets_abancart_campaign_group
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 feature_flag
1 iqit_elementor_category_shop
1 iqitreviews_products
1 attribute
1 attribute_lang
1 attribute_group
1 multipleprices_configuration_lang
1 ybc_blog_post
1 ybc_blog_post_shop
1 ybc_blog_post_lang
1 ybc_blog_post_category
1 ybc_blog_post_related_categories
1 customer
1 employee
1 ybc_blog_employee
1 ybc_blog_comment
1 cms
1 cms_lang
1 cms_shop
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Category 52 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 8086]
/classes/Meta.php:380 (__construct) [id: 8086]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ganalyticspro/lib/gtag/categoryTag.php:33 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:64 (__construct) [id: 8086]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:171 (__construct) [id: 8086]
/modules/connettore/connettore.php:490 (__construct) [id: 8086]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 8086]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 8086]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 8086]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8086]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1338 (__construct) [id: 2]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 8086]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 8086]
Product 42 /classes/Link.php:113 (__construct) [id: 23354]
/classes/Link.php:113 (__construct) [id: 23534]
/classes/Link.php:113 (__construct) [id: 23536]
/classes/Link.php:113 (__construct) [id: 23537]
/classes/Link.php:113 (__construct) [id: 23538]
/classes/Link.php:113 (__construct) [id: 23582]
/classes/Link.php:113 (__construct) [id: 23583]
/classes/Link.php:113 (__construct) [id: 23584]
/classes/Link.php:113 (__construct) [id: 23727]
/classes/Link.php:113 (__construct) [id: 23728]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23344]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23345]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23346]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23347]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23348]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23349]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23350]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23351]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23352]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23354]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23355]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23356]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23357]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23358]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23534]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23535]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23536]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23537]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23538]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23582]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23583]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23584]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23727]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23728]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 23538]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23538]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23538]
/classes/Link.php:113 (__construct) [id: 23538]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 23538]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23538]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23538]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23538]
Address 34 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5958 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
Cart 7 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Language 6 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/ganalyticspro/lib/gtag/categoryTag.php:52 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:139 (__construct) [id: 1]
Country 6 /config/config.inc.php:146 (__construct) [id: 10]
/classes/controller/FrontController.php:354 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1767 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 19]
Configuration 5 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 5 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
OrderState 5 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:695 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:211 (__construct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 234]
/classes/controller/FrontController.php:1766 (__construct) [id: 234]
Group 2 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:370 (__construct) [id: 1]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
MultiplepricesConfiguration 1 /modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
CMS 1 /classes/Link.php:555 (__construct) [id: 3]
AddressFormat 1 /classes/controller/FrontController.php:1761 (generateAddress) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1694 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1691 (__construct) [id: 0]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/ircmaxell/password-compat/lib/password.php
40 /vendor/api-platform/core/src/deprecation.php
41 /vendor/api-platform/core/src/Api/FilterInterface.php
42 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
43 /vendor/api-platform/core/src/deprecated_interfaces.php
44 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
46 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
56 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
58 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
59 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
61 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
62 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
63 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
65 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
66 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
67 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
68 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
69 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
70 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
71 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
72 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
73 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
74 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
75 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
76 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
77 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
78 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
79 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
86 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
90 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
94 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
97 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
98 /vendor/psr/container/src/ContainerInterface.php
99 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /override/classes/Configuration.php
134 /classes/Configuration.php
135 /classes/Validate.php
136 /classes/cache/Cache.php
137 /src/Adapter/EntityMapper.php
138 /classes/db/DbQuery.php
139 /src/Core/Addon/Theme/ThemeManagerBuilder.php
140 /vendor/psr/log/Psr/Log/NullLogger.php
141 /vendor/psr/log/Psr/Log/AbstractLogger.php
142 /vendor/psr/log/Psr/Log/LoggerInterface.php
143 /src/Adapter/Configuration.php
144 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
145 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
146 /src/Core/ConfigurationInterface.php
147 /src/Core/Addon/Theme/ThemeRepository.php
148 /src/Core/Addon/AddonRepositoryInterface.php
149 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
150 /src/Core/Addon/Theme/Theme.php
151 /src/Core/Addon/AddonInterface.php
152 /src/Core/Util/File/YamlParser.php
153 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
154 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
155 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
157 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
158 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
159 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
160 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
161 /var/cache/dev/yaml/84a464d0176e3f6031f8e8ec956aa9cf.php
162 /src/Core/Util/ArrayFinder.php
163 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
164 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
165 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
166 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
167 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
168 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
169 /config/defines_uri.inc.php
170 /classes/Language.php
171 /src/Core/Language/LanguageInterface.php
172 /classes/Country.php
173 /classes/PrestaShopCollection.php
174 /classes/shop/ShopGroup.php
175 /classes/Cookie.php
176 /classes/PhpEncryption.php
177 /classes/PhpEncryptionEngine.php
178 /vendor/defuse/php-encryption/src/Key.php
179 /vendor/defuse/php-encryption/src/Encoding.php
180 /vendor/defuse/php-encryption/src/Core.php
181 /src/Core/Session/SessionHandler.php
182 /src/Core/Session/SessionHandlerInterface.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
197 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
198 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
199 /config/smarty.config.inc.php
200 /classes/Smarty/SmartyDev.php
201 /vendor/smarty/smarty/libs/Smarty.class.php
202 /vendor/smarty/smarty/libs/functions.php
203 /vendor/smarty/smarty/libs/Autoloader.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
213 /config/smartyfront.config.inc.php
214 /classes/Smarty/SmartyResourceModule.php
215 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
217 /classes/Smarty/SmartyResourceParent.php
218 /classes/Smarty/SmartyLazyRegister.php
219 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
220 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
221 /classes/Customer.php
222 /classes/Group.php
223 /override/classes/Link.php
224 /classes/Link.php
225 /classes/shop/ShopUrl.php
226 /override/classes/Dispatcher.php
227 /classes/Dispatcher.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
232 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
233 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
234 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
235 /src/Adapter/SymfonyContainer.php
236 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
237 /config/db_slave_server.inc.php
238 /modules/doofinder/doofinder.php
239 /modules/doofinder/lib/dfTools.class.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
241 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
242 /classes/Translate.php
243 /modules/doofinder/translations/it.php
244 /src/PrestaShopBundle/Translation/TranslatorComponent.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
246 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
247 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
248 /vendor/symfony/contracts/Translation/TranslatorInterface.php
249 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
250 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
252 /src/PrestaShopBundle/Translation/TranslatorInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
258 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
259 /vendor/symfony/contracts/Translation/TranslatorTrait.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
261 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
262 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
264 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
266 /modules/ybc_blog/ybc_blog.php
267 /modules/ybc_blog/classes/ybc_blog_category_class.php
268 /modules/ybc_blog/classes/ybc_blog_post_class.php
269 /modules/ybc_blog/classes/ybc_blog_paggination_class.php
270 /modules/ybc_blog/classes/ybc_blog_comment_class.php
271 /modules/ybc_blog/classes/ybc_blog_reply_class.php
272 /modules/ybc_blog/classes/ybc_blog_polls_class.php
273 /modules/ybc_blog/classes/ybc_blog_slide_class.php
274 /modules/ybc_blog/classes/ybc_blog_gallery_class.php
275 /modules/ybc_blog/classes/ybc_blog_link_class.php
276 /modules/ybc_blog/classes/ybc_blog_employee_class.php
277 /modules/ybc_blog/classes/ybc_blog_email_template_class.php
278 /modules/ybc_blog/classes/ImportExport.php
279 /modules/ybc_blog/classes/ybc_browser.php
280 /modules/ybc_blog/ybc_blog_defines.php
281 /modules/ybc_blog/classes/ybc_chatgpt.php
282 /modules/ybc_blog/classes/ybc_chatgpt_message.php
283 /modules/ybc_blog/src/FormType/DescriptionType.php
284 /src/PrestaShopBundle/Form/Admin/Sell/Product/Description/DescriptionType.php
285 /src/PrestaShopBundle/Form/Admin/Type/TranslatorAwareType.php
286 /src/PrestaShopBundle/Form/Admin/Type/CommonAbstractType.php
287 /vendor/symfony/symfony/src/Symfony/Component/Form/AbstractType.php
288 /vendor/symfony/symfony/src/Symfony/Component/Form/FormTypeInterface.php
289 /modules/ybc_blog/translations/it.php
290 /modules/simpleimportproduct/simpleimportproduct.php
291 /modules/simpleimportproduct/classes/mpmTools.php
292 /modules/simpleimportproduct/translations/it.php
293 /classes/Supplier.php
294 /override/classes/Feature.php
295 /classes/Feature.php
296 /modules/ets_abandonedcart/ets_abandonedcart.php
297 /modules/ets_abandonedcart/classes/EtsAbancartCore.php
298 /modules/ets_abandonedcart/classes/EtsAbancartCache.php
299 /modules/ets_abandonedcart/classes/EtsAbancartValidate.php
300 /modules/ets_abandonedcart/classes/EtsAbancartTools.php
301 /modules/ets_abandonedcart/classes/EtsAbancartMail.php
302 /classes/Mail.php
303 /modules/ets_abandonedcart/classes/EtsAbancartIndex.php
304 /modules/ets_abandonedcart/classes/EtsAbancartIndexCustomer.php
305 /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php
306 /modules/ets_abandonedcart/classes/EtsAbancartReminder.php
307 /modules/ets_abandonedcart/classes/EtsAbancartEmailTemplate.php
308 /modules/ets_abandonedcart/classes/EtsAbancartTracking.php
309 /modules/ets_abandonedcart/classes/EtsAbancartDisplayTracking.php
310 /modules/ets_abandonedcart/classes/EtsAbancartReminderForm.php
311 /modules/ets_abandonedcart/classes/EtsAbancartQueue.php
312 /modules/ets_abandonedcart/classes/EtsAbancartShoppingCart.php
313 /modules/ets_abandonedcart/classes/EtsAbancartUnsubscribers.php
314 /modules/ets_abandonedcart/classes/EtsAbancartDefines.php
315 /modules/ets_abandonedcart/classes/EtsAbancartForm.php
316 /modules/ets_abandonedcart/classes/EtsAbancartFormSubmit.php
317 /modules/ets_abandonedcart/classes/EtsAbancartField.php
318 /modules/ets_abandonedcart/classes/EtsAbancartFieldValue.php
319 /modules/ets_abandonedcart/translations/it.php
320 /modules/ps_mbo/ps_mbo.php
321 /modules/ps_mbo/vendor/autoload.php
322 /modules/ps_mbo/vendor/composer/autoload_real.php
323 /modules/ps_mbo/vendor/composer/platform_check.php
324 /modules/ps_mbo/vendor/composer/autoload_static.php
325 /modules/ps_mbo/vendor/clue/stream-filter/src/functions_include.php
326 /modules/ps_mbo/vendor/clue/stream-filter/src/functions.php
327 /modules/ps_mbo/vendor/php-http/message/src/filters.php
328 /modules/ps_mbo/vendor/sentry/sentry/src/functions.php
329 /modules/ps_mbo/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
330 /modules/ps_mbo/vendor/symfony/string/Resources/functions.php
331 /modules/ps_mbo/bootstrap.php
332 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
333 /modules/ps_mbo/src/Traits/HaveTabs.php
334 /modules/ps_mbo/src/Traits/UseHooks.php
335 /modules/ps_mbo/src/Traits/Hooks/UseDisplayBackOfficeEmployeeMenu.php
336 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneOne.php
337 /modules/ps_mbo/src/Traits/HaveCdcComponent.php
338 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneTwo.php
339 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneThree.php
340 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminThemesListAfter.php
341 /modules/ps_mbo/src/Traits/Hooks/UseDisplayDashboardTop.php
342 /modules/ps_mbo/src/Traits/Hooks/UseActionAdminControllerSetMedia.php
343 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeInstallModule.php
344 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAdminToolbarButtons.php
345 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAlternativeSearchPanels.php
346 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminAfterHeader.php
347 /modules/ps_mbo/src/Traits/Hooks/UseDisplayModuleConfigureExtraButtons.php
348 /modules/ps_mbo/src/Traits/Hooks/UseActionListModules.php
349 /modules/ps_mbo/src/Traits/Hooks/UseActionModuleRegisterHookAfter.php
350 /modules/ps_mbo/src/Traits/Hooks/UseDisplayEmptyModuleCategoryExtraMessage.php
351 /modules/ps_mbo/src/Traits/Hooks/UseActionDispatcherBefore.php
352 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectShopUrlUpdateAfter.php
353 /modules/ps_mbo/src/Traits/Hooks/UseActionGeneralPageSave.php
354 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeUpgradeModule.php
355 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeDeleteBefore.php
356 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeUpdateBefore.php
357 /modules/ps_mbo/src/Traits/HaveShopOnExternalService.php
358 /modules/ps_mbo/src/Tab/TabInterface.php
359 /src/PrestaShopBundle/Translation/DomainNormalizer.php
360 /src/Adapter/Localization/LegacyTranslator.php
361 /modules/ps_mbo/vendor/symfony/string/UnicodeString.php
362 /modules/ps_mbo/vendor/symfony/string/AbstractUnicodeString.php
363 /modules/ps_mbo/vendor/symfony/string/AbstractString.php
364 /controllers/front/listing/CategoryController.php
365 /classes/controller/ProductListingFrontController.php
366 /classes/controller/ProductPresentingFrontController.php
367 /classes/controller/FrontController.php
368 /src/Adapter/Presenter/Object/ObjectPresenter.php
369 /src/Adapter/Presenter/PresenterInterface.php
370 /src/Adapter/Presenter/Cart/CartPresenter.php
371 /src/Adapter/Product/PriceFormatter.php
372 /src/Adapter/Image/ImageRetriever.php
373 /classes/tax/TaxConfiguration.php
374 /classes/Smarty/TemplateFinder.php
375 /classes/assets/StylesheetManager.php
376 /classes/assets/AbstractAssetManager.php
377 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
378 /classes/assets/JavascriptManager.php
379 /classes/assets/CccReducer.php
380 /modules/iqitthemeeditor/iqitthemeeditor.php
381 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
382 /modules/iqitthemeeditor/translations/it.php
383 /override/classes/Category.php
384 /classes/Category.php
385 /classes/webservice/WebserviceRequest.php
386 /src/Adapter/ContainerBuilder.php
387 /src/Adapter/Environment.php
388 /src/Core/EnvironmentInterface.php
389 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
390 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
391 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
392 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
393 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
394 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
395 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
396 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
397 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
398 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
399 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
400 /vendor/symfony/contracts/Service/ResetInterface.php
401 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
402 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
403 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
404 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
405 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
406 /vendor/symfony/contracts/Cache/ItemInterface.php
407 /vendor/psr/cache/src/CacheItemInterface.php
408 /vendor/psr/cache/src/CacheItemPoolInterface.php
409 /vendor/symfony/contracts/Cache/CacheInterface.php
410 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
411 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
412 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
413 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
414 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
415 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
416 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
417 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
418 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
419 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
420 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
421 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
422 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
423 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
424 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
425 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
426 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
427 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
428 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
429 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
430 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
431 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
432 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
433 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
434 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
435 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
436 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
437 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
438 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
439 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
440 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
441 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
442 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
443 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
444 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
445 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
446 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
447 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
448 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
449 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
450 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
451 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
452 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
453 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
454 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
455 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
456 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
457 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
458 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
459 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
460 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
461 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
462 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
463 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
464 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
465 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
466 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
467 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
468 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
469 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
470 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
471 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
472 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
473 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
474 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
475 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
476 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
477 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
478 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
479 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
480 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
481 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
482 /var/cache/dev/FrontContainer.php
483 /src/Adapter/Container/LegacyContainer.php
484 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
485 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
486 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
487 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
488 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
489 /vendor/psr/container/src/ContainerExceptionInterface.php
490 /vendor/psr/container/src/NotFoundExceptionInterface.php
491 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
492 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
493 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
494 /src/Adapter/Container/LegacyContainerInterface.php
495 /modules/ps_shoppingcart/vendor/autoload.php
496 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
497 /modules/ps_shoppingcart/vendor/composer/platform_check.php
498 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
499 /modules/ps_emailsubscription/vendor/autoload.php
500 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
501 /modules/ps_emailsubscription/vendor/composer/platform_check.php
502 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
503 /modules/productcomments/vendor/autoload.php
504 /modules/productcomments/vendor/composer/autoload_real.php
505 /modules/productcomments/vendor/composer/platform_check.php
506 /modules/productcomments/vendor/composer/autoload_static.php
507 /modules/ps_facetedsearch/vendor/autoload.php
508 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
509 /modules/ps_facetedsearch/vendor/composer/platform_check.php
510 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
511 /modules/contactform/vendor/autoload.php
512 /modules/contactform/vendor/composer/autoload_real.php
513 /modules/contactform/vendor/composer/platform_check.php
514 /modules/contactform/vendor/composer/autoload_static.php
515 /modules/ps_emailalerts/vendor/autoload.php
516 /modules/ps_emailalerts/vendor/composer/autoload_real.php
517 /modules/ps_emailalerts/vendor/composer/platform_check.php
518 /modules/ps_emailalerts/vendor/composer/autoload_static.php
519 /modules/ps_checkpayment/vendor/autoload.php
520 /modules/ps_checkpayment/vendor/composer/autoload_real.php
521 /modules/ps_checkpayment/vendor/composer/platform_check.php
522 /modules/ps_checkpayment/vendor/composer/autoload_static.php
523 /modules/ps_wirepayment/vendor/autoload.php
524 /modules/ps_wirepayment/vendor/composer/autoload_real.php
525 /modules/ps_wirepayment/vendor/composer/platform_check.php
526 /modules/ps_wirepayment/vendor/composer/autoload_static.php
527 /modules/statscheckup/vendor/autoload.php
528 /modules/statscheckup/vendor/composer/autoload_real.php
529 /modules/statscheckup/vendor/composer/platform_check.php
530 /modules/statscheckup/vendor/composer/autoload_static.php
531 /modules/statscatalog/vendor/autoload.php
532 /modules/statscatalog/vendor/composer/autoload_real.php
533 /modules/statscatalog/vendor/composer/platform_check.php
534 /modules/statscatalog/vendor/composer/autoload_static.php
535 /modules/dashactivity/vendor/autoload.php
536 /modules/dashactivity/vendor/composer/autoload_real.php
537 /modules/dashactivity/vendor/composer/platform_check.php
538 /modules/dashactivity/vendor/composer/autoload_static.php
539 /modules/dashproducts/vendor/autoload.php
540 /modules/dashproducts/vendor/composer/autoload_real.php
541 /modules/dashproducts/vendor/composer/platform_check.php
542 /modules/dashproducts/vendor/composer/autoload_static.php
543 /modules/dashtrends/vendor/autoload.php
544 /modules/dashtrends/vendor/composer/autoload_real.php
545 /modules/dashtrends/vendor/composer/platform_check.php
546 /modules/dashtrends/vendor/composer/autoload_static.php
547 /modules/ps_distributionapiclient/vendor/autoload.php
548 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
549 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
550 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
551 /modules/pagesnotfound/vendor/autoload.php
552 /modules/pagesnotfound/vendor/composer/autoload_real.php
553 /modules/pagesnotfound/vendor/composer/platform_check.php
554 /modules/pagesnotfound/vendor/composer/autoload_static.php
555 /modules/statsproduct/vendor/autoload.php
556 /modules/statsproduct/vendor/composer/autoload_real.php
557 /modules/statsproduct/vendor/composer/platform_check.php
558 /modules/statsproduct/vendor/composer/autoload_static.php
559 /modules/ps_themecusto/vendor/autoload.php
560 /modules/ps_themecusto/vendor/composer/autoload_real.php
561 /modules/ps_themecusto/vendor/composer/platform_check.php
562 /modules/ps_themecusto/vendor/composer/autoload_static.php
563 /modules/ps_checkout/vendor/autoload.php
564 /modules/ps_checkout/vendor/composer/autoload_real.php
565 /modules/ps_checkout/vendor/composer/platform_check.php
566 /modules/ps_checkout/vendor/composer/autoload_static.php
567 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
568 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment.php
569 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Client.php
570 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
571 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
572 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
573 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
574 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
575 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
576 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Version.php
577 /modules/ps_accounts/vendor/autoload.php
578 /modules/ps_accounts/vendor/composer/autoload_real.php
579 /modules/ps_accounts/vendor/composer/platform_check.php
580 /modules/ps_accounts/vendor/composer/autoload_static.php
581 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
582 /modules/ps_accounts/vendor/symfony/polyfill-php70/bootstrap.php
583 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions_include.php
584 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions.php
585 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions_include.php
586 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions.php
587 /modules/ps_accounts/vendor/symfony/polyfill-apcu/bootstrap.php
588 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions_include.php
589 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions.php
590 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
591 /modules/gmerchantcenterpro/vendor/autoload.php
592 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
593 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
594 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
595 /modules/ganalyticspro/vendor/autoload.php
596 /modules/ganalyticspro/vendor/composer/autoload_real.php
597 /modules/ganalyticspro/vendor/composer/platform_check.php
598 /modules/ganalyticspro/vendor/composer/autoload_static.php
599 /modules/fattura24/vendor/autoload.php
600 /modules/fattura24/vendor/composer/autoload_real.php
601 /modules/fattura24/vendor/composer/autoload_static.php
602 /modules/payplug/vendor/autoload.php
603 /modules/payplug/vendor/composer/autoload_real.php
604 /modules/payplug/vendor/composer/autoload_static.php
605 /modules/sendinblue/vendor/autoload.php
606 /modules/sendinblue/vendor/composer/autoload_real.php
607 /modules/sendinblue/vendor/composer/platform_check.php
608 /modules/sendinblue/vendor/composer/autoload_static.php
609 /modules/gremarketing/vendor/autoload.php
610 /modules/gremarketing/vendor/composer/autoload_real.php
611 /modules/gremarketing/vendor/composer/platform_check.php
612 /modules/gremarketing/vendor/composer/autoload_static.php
613 /modules/feedaty/vendor/autoload.php
614 /modules/feedaty/vendor/composer/autoload_real.php
615 /modules/feedaty/vendor/composer/autoload_static.php
616 /modules/seoimg/vendor/autoload.php
617 /modules/seoimg/vendor/composer/autoload_real.php
618 /modules/seoimg/vendor/composer/platform_check.php
619 /modules/seoimg/vendor/composer/autoload_static.php
620 /modules/psrecaptcha/vendor/autoload.php
621 /modules/psrecaptcha/vendor/composer/autoload_real.php
622 /modules/psrecaptcha/vendor/composer/platform_check.php
623 /modules/psrecaptcha/vendor/composer/autoload_static.php
624 /modules/autoupgrade/vendor/autoload.php
625 /modules/autoupgrade/vendor/composer/autoload_real.php
626 /modules/autoupgrade/vendor/composer/autoload_static.php
627 /modules/lgcookieslaw/vendor/autoload.php
628 /modules/lgcookieslaw/vendor/composer/autoload_real.php
629 /modules/lgcookieslaw/vendor/composer/autoload_static.php
630 /src/Core/Localization/Locale/Repository.php
631 /src/Core/Localization/Locale/RepositoryInterface.php
632 /src/Core/Localization/CLDR/LocaleRepository.php
633 /src/Core/Localization/CLDR/LocaleDataSource.php
634 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
635 /src/Core/Data/Layer/AbstractDataLayer.php
636 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
640 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
641 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
642 /vendor/symfony/contracts/Cache/CacheTrait.php
643 /vendor/psr/cache/src/InvalidArgumentException.php
644 /vendor/psr/cache/src/CacheException.php
645 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
646 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
647 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
648 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
649 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
650 /src/Core/Localization/CLDR/Reader.php
651 /src/Core/Localization/CLDR/ReaderInterface.php
652 /src/Core/Localization/Currency/Repository.php
653 /src/Core/Localization/Currency/RepositoryInterface.php
654 /src/Core/Localization/Currency/CurrencyDataSource.php
655 /src/Core/Localization/Currency/DataSourceInterface.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
657 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
658 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
659 /src/Adapter/Currency/CurrencyDataProvider.php
660 /src/Core/Currency/CurrencyDataProviderInterface.php
661 /src/Adapter/LegacyContext.php
662 /src/Adapter/Tools.php
663 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
664 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
665 /vendor/prestashop/decimal/src/Operation/Rounding.php
666 /src/Core/Localization/Locale.php
667 /src/Core/Localization/LocaleInterface.php
668 /src/Core/Localization/Specification/Price.php
669 /src/Core/Localization/Specification/Number.php
670 /src/Core/Localization/Specification/NumberInterface.php
671 /src/Core/Localization/Specification/Factory.php
672 /src/Core/Localization/CLDR/LocaleData.php
673 /src/Core/Localization/CLDR/NumberSymbolsData.php
674 /src/Core/Localization/CLDR/CurrencyData.php
675 /src/Core/Localization/CLDR/Locale.php
676 /src/Core/Localization/CLDR/LocaleInterface.php
677 /src/Core/Localization/Specification/NumberSymbolList.php
678 /classes/Currency.php
679 /src/Core/Localization/Currency/LocalizedCurrencyId.php
680 /src/Core/Localization/Currency/CurrencyData.php
681 /src/Core/Localization/Currency/CurrencyCollection.php
682 /src/Core/Localization/Currency.php
683 /src/Core/Localization/CurrencyInterface.php
684 /src/Core/Localization/Specification/NumberCollection.php
685 /src/Core/Localization/Number/Formatter.php
686 /classes/Cart.php
687 /src/Adapter/AddressFactory.php
688 /classes/CartRule.php
689 /override/classes/Product.php
690 /classes/Product.php
691 /src/Core/Domain/Product/ValueObject/RedirectType.php
692 /src/Core/Util/DateTime/DateTime.php
693 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
694 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
695 /src/Core/Domain/Product/ValueObject/ProductType.php
696 /src/Core/Domain/Product/ValueObject/Reference.php
697 /src/Core/Domain/Product/ValueObject/Ean13.php
698 /src/Core/Domain/Product/ValueObject/Isbn.php
699 /src/Core/Domain/Product/ValueObject/Upc.php
700 /src/Core/Domain/Product/ProductSettings.php
701 /src/Core/Domain/Shop/ValueObject/ShopId.php
702 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
703 /modules/ps_emailsubscription/ps_emailsubscription.php
704 /src/Core/Module/WidgetInterface.php
705 /classes/Media.php
706 /modules/ps_emailalerts/ps_emailalerts.php
707 /modules/ps_emailalerts/MailAlert.php
708 /modules/ps_checkout/ps_checkout.php
709 /classes/PaymentModule.php
710 /modules/ps_checkout/translations/it.php
711 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
712 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
713 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
714 /var/cache/dev/Ps_checkout8400FrontContainer.php
715 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
716 /modules/ps_checkout/src/Validator/MerchantValidator.php
717 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
718 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
719 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
720 /modules/ps_checkout/src/Shop/ShopProvider.php
721 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
722 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
723 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
724 /modules/ps_checkout/src/Repository/PsAccountRepository.php
725 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
726 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
727 /src/Core/Addon/Module/ModuleManagerBuilder.php
728 /var/cache/dev/yaml/1deb99a1745c58282b5926d8d607faaa.php
729 /src/Adapter/LegacyLogger.php
730 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
731 /src/Adapter/Module/ModuleDataProvider.php
732 /src/Adapter/Module/AdminModuleDataProvider.php
733 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
734 /src/Adapter/Module/Module.php
735 /src/Core/Module/ModuleInterface.php
736 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
737 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
738 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
739 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
740 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
741 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
742 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
743 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
744 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
745 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
746 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
747 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
748 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
749 /src/Adapter/Module/ModuleDataUpdater.php
750 /src/Core/Module/ModuleManager.php
751 /src/Core/Module/ModuleManagerInterface.php
752 /src/Core/Module/ModuleRepository.php
753 /src/Core/Module/ModuleRepositoryInterface.php
754 /src/Adapter/HookManager.php
755 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
756 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
757 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
758 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
759 /modules/ps_distributionapiclient/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
760 /src/Core/Hook/HookDispatcherInterface.php
761 /modules/ps_accounts/ps_accounts.php
762 /modules/ps_accounts/src/Hook/HookableTrait.php
763 /modules/ps_accounts/src/Module/Install.php
764 /modules/ps_accounts/translations/it.php
765 /modules/ps_accounts/src/DependencyInjection/ServiceContainer.php
766 /modules/ps_accounts/src/DependencyInjection/ContainerProvider.php
767 /var/cache/dev/Ps_accounts701FrontContainer.php
768 /modules/ps_accounts/src/Service/PsAccountsService.php
769 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
770 /modules/ps_accounts/src/Account/Session/Session.php
771 /modules/ps_accounts/src/Account/Session/SessionInterface.php
772 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
773 /modules/ps_accounts/src/Adapter/Configuration.php
774 /modules/ps_accounts/src/Account/Session/ShopSession.php
775 /modules/ps_accounts/src/Account/Session/RefreshFirebaseTokens.php
776 /modules/ps_accounts/src/Provider/OAuth2/ShopProvider.php
777 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/PrestaShop.php
778 /modules/ps_accounts/vendor/league/oauth2-client/src/Provider/AbstractProvider.php
779 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/ArrayAccessorTrait.php
780 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/GuardedPropertyTrait.php
781 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/QueryBuilderTrait.php
782 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/BearerAuthorizationTrait.php
783 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/LogoutTrait.php
784 /modules/ps_accounts/src/Provider/OAuth2/Oauth2Client.php
785 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
786 /modules/ps_accounts/src/Type/Enum.php
787 /modules/ps_accounts/src/Adapter/Link.php
788 /modules/ps_accounts/src/Context/ShopContext.php
789 /modules/ps_accounts/vendor/league/oauth2-client/src/Grant/GrantFactory.php
790 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/RequestFactory.php
791 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Client.php
792 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/ClientInterface.php
793 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/HandlerStack.php
794 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/Proxy.php
795 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlMultiHandler.php
796 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactory.php
797 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactoryInterface.php
798 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlHandler.php
799 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/StreamHandler.php
800 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Middleware.php
801 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/RedirectMiddleware.php
802 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/PostAuthOptionProvider.php
803 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/OptionProviderInterface.php
804 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
805 /modules/ps_accounts/src/Account/LinkShop.php
806 /modules/ps_checkout/src/Context/PrestaShopContext.php
807 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
808 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
809 /modules/ps_checkout/src/Version/Version.php
810 /modules/psrecaptcha/psrecaptcha.php
811 /modules/psrecaptcha/translations/it.php
812 /classes/ProductDownload.php
813 /classes/tax/Tax.php
814 /src/Core/Localization/CLDR/ComputingPrecision.php
815 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
816 /src/Core/Cart/Calculator.php
817 /src/Core/Cart/CartRowCollection.php
818 /src/Core/Cart/Fees.php
819 /src/Core/Cart/AmountImmutable.php
820 /src/Core/Cart/CartRuleCollection.php
821 /src/Core/Cart/CartRuleCalculator.php
822 /src/Adapter/Product/PriceCalculator.php
823 /classes/order/Order.php
824 /src/Core/Cart/CartRow.php
825 /vendor/prestashop/decimal/src/DecimalNumber.php
826 /vendor/prestashop/decimal/src/Builder.php
827 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
828 /classes/Gender.php
829 /classes/Risk.php
830 /classes/Meta.php
831 /modules/revsliderprestashop/revsliderprestashop.php
832 /modules/revsliderprestashop/rev-loader.php
833 /modules/revsliderprestashop/includes/revslider_db.class.php
834 /modules/revsliderprestashop/includes/data.class.php
835 /modules/revsliderprestashop/includes/functions.class.php
836 /modules/revsliderprestashop/includes/em-integration.class.php
837 /modules/revsliderprestashop/includes/cssparser.class.php
838 /modules/revsliderprestashop/includes/woocommerce.class.php
839 /modules/revsliderprestashop/includes/wpml.class.php
840 /modules/revsliderprestashop/includes/colorpicker.class.php
841 /modules/revsliderprestashop/includes/navigation.class.php
842 /modules/revsliderprestashop/includes/object-library.class.php
843 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
844 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
845 /modules/revsliderprestashop/includes/extension.class.php
846 /modules/revsliderprestashop/includes/favorite.class.php
847 /modules/revsliderprestashop/includes/aq-resizer.class.php
848 /modules/revsliderprestashop/includes/external-sources.class.php
849 /modules/revsliderprestashop/includes/page-template.class.php
850 /modules/revsliderprestashop/includes/slider.class.php
851 /modules/revsliderprestashop/includes/slide.class.php
852 /modules/revsliderprestashop/includes/output.class.php
853 /modules/revsliderprestashop/public/revslider-front.class.php
854 /modules/revsliderprestashop/includes/backwards.php
855 /modules/revsliderprestashop/admin/includes/class-pclzip.php
856 /modules/revsliderprestashop/admin/includes/license.class.php
857 /modules/revsliderprestashop/admin/includes/addons.class.php
858 /modules/revsliderprestashop/admin/includes/template.class.php
859 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
860 /modules/revsliderprestashop/admin/includes/folder.class.php
861 /modules/revsliderprestashop/admin/includes/import.class.php
862 /modules/revsliderprestashop/admin/includes/export.class.php
863 /modules/revsliderprestashop/admin/includes/export-html.class.php
864 /modules/revsliderprestashop/admin/includes/newsletter.class.php
865 /modules/revsliderprestashop/admin/revslider-admin.class.php
866 /modules/revsliderprestashop/includes/update.class.php
867 /modules/revsliderprestashop/includes/resize-imag.php
868 /modules/revsliderprestashop/translations/it.php
869 /override/classes/Address.php
870 /classes/Address.php
871 /modules/arteinvoice/arteinvoice.php
872 /modules/arteinvoice/translations/it.php
873 /classes/ImageType.php
874 /classes/State.php
875 /src/Core/Security/PasswordPolicyConfiguration.php
876 /src/Core/Configuration/DataConfigurationInterface.php
877 /src/Core/Security/Hashing.php
878 /src/Core/Filter/FrontEndObject/MainFilter.php
879 /src/Core/Filter/FilterInterface.php
880 /src/Core/Filter/FrontEndObject/CartFilter.php
881 /src/Core/Filter/HashMapWhitelistFilter.php
882 /src/Core/Filter/CollectionFilter.php
883 /src/Core/Filter/FrontEndObject/ProductFilter.php
884 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
885 /src/Core/Filter/FrontEndObject/CustomerFilter.php
886 /src/Core/Filter/FrontEndObject/ShopFilter.php
887 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
888 /modules/lgcookieslaw/lgcookieslaw.php
889 /modules/lgcookieslaw/config/config.inc.php
890 /modules/lgcookieslaw/translations/it.php
891 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php
892 /vendor/defuse/php-encryption/src/Crypto.php
893 /vendor/defuse/php-encryption/src/KeyOrPassword.php
894 /vendor/defuse/php-encryption/src/RuntimeTests.php
895 /vendor/defuse/php-encryption/src/DerivedKeys.php
896 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
897 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
898 /classes/Smarty/SmartyDevTemplate.php
899 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
900 /var/cache/dev/smarty/compile/37/43/2c/37432c861bff16f5b2f4e73e17290a859706693a_2.file.view_cookies_scripts_content.tpl.php
901 /var/cache/dev/smarty/compile/19/c5/80/19c58092aad1b9d2c0faefe208b7555546f1a69f_2.file.view_header.tpl.php
902 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
903 /modules/ps_shoppingcart/ps_shoppingcart.php
904 /modules/productcomments/productcomments.php
905 /modules/iqitcompare/iqitcompare.php
906 /modules/iqitcompare/translations/it.php
907 /modules/iqitcontactpage/iqitcontactpage.php
908 /modules/iqitcontactpage/translations/it.php
909 /modules/iqitcountdown/iqitcountdown.php
910 /modules/iqitcountdown/translations/it.php
911 /modules/iqitelementor/iqitelementor.php
912 /modules/iqitelementor/src/IqitElementorLanding.php
913 /modules/iqitelementor/src/IqitElementorTemplate.php
914 /modules/iqitelementor/src/IqitElementorProduct.php
915 /modules/iqitelementor/src/IqitElementorCategory.php
916 /modules/iqitelementor/src/IqitElementorContent.php
917 /modules/iqitelementor/src/iqitElementorWpHelper.php
918 /modules/iqitelementor/includes/plugin-elementor.php
919 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
920 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
921 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
922 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
923 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
924 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
925 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
926 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
927 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
928 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
929 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
930 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
931 /modules/iqitelementor/translations/it.php
932 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
933 /modules/iqitfreedeliverycount/translations/it.php
934 /modules/iqitmegamenu/iqitmegamenu.php
935 /modules/iqitmegamenu/models/IqitMenuTab.php
936 /modules/iqitmegamenu/models/IqitMenuHtml.php
937 /modules/iqitmegamenu/models/IqitMenuLinks.php
938 /modules/iqitmegamenu/translations/it.php
939 /modules/iqitreviews/iqitreviews.php
940 /modules/iqitreviews/src/IqitProductReview.php
941 /modules/iqitwishlist/iqitwishlist.php
942 /modules/iqitwishlist/src/IqitWishlistProduct.php
943 /modules/iqitwishlist/translations/it.php
944 /modules/iqitextendedproduct/iqitextendedproduct.php
945 /modules/iqitextendedproduct/src/IqitThreeSixty.php
946 /modules/iqitextendedproduct/src/IqitProductVideo.php
947 /modules/iqitextendedproduct/translations/it.php
948 /modules/artproduttori/artproduttori.php
949 /modules/artproduttori/translations/it.php
950 /var/cache/dev/smarty/compile/shopwarehouse/2a/78/bf/2a78bfe324326a3e5b719fcedc43fa2217413e51_2.file.scriptV9.tpl.php
951 /modules/ganalyticspro/ganalyticspro.php
952 /modules/ganalyticspro/translations/it.php
953 /modules/ganalyticspro/lib/moduleTools.php
954 /modules/ganalyticspro/conf/moduleConfiguration.php
955 /modules/ganalyticspro/lib/hook/hookController.php
956 /modules/ganalyticspro/lib/hook/hookDisplay.php
957 /modules/ganalyticspro/lib/hook/hookInterface.php
958 /modules/ganalyticspro/lib/gtag/baseTag.php
959 /modules/ganalyticspro/lib/gtag/categoryTag.php
960 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
961 /classes/Combination.php
962 /classes/stock/StockAvailable.php
963 /classes/SpecificPrice.php
964 /classes/tax/TaxManagerFactory.php
965 /classes/tax/TaxRulesTaxManager.php
966 /classes/tax/TaxManagerInterface.php
967 /classes/tax/TaxCalculator.php
968 /classes/GroupReduction.php
969 /classes/Pack.php
970 /override/classes/Manufacturer.php
971 /classes/Manufacturer.php
972 /classes/Tag.php
973 /modules/ganalyticspro/models/orderRefund.php
974 /modules/ganalyticspro/models/orderPartialRefund.php
975 /var/cache/dev/smarty/compile/shopwarehouse/1c/84/58/1c8458cc9d4e9ed9c19ec87cbfcb12174e2707f9_2.file.header.tpl.php
976 /var/cache/dev/smarty/compile/shopwarehouse/b4/00/ef/b400eff9187b1d53d67faeda1e6035db24007b26_2.file.apichatgpt.tpl.php
977 /var/cache/dev/smarty/compile/shopwarehouse/67/1c/ce/671ccec8ce19597b0b74aa75c89c3e503b4f00be_2.file.head.tpl.php
978 /modules/shinystat/shinystat.php
979 /modules/shinystat/translations/it.php
980 /modules/ets_integrategooglemarketing/ets_integrategooglemarketing.php
981 /modules/ets_integrategooglemarketing/classes/Ets_integrategooglemarketing_defines.php
982 /modules/ets_integrategooglemarketing/translations/it.php
983 /var/cache/dev/smarty/compile/shopwarehouse/a5/b7/a4/a5b7a45ca285fcbfe2b88dceb9824ebefab6b6ac_2.file.google_tag_head.tpl.php
984 /var/cache/dev/smarty/compile/shopwarehouse/ce/33/81/ce33814f2d98ddedf15ce7084df0cb6273514cb7_2.file.google_search_console.tpl.php
985 /modules/cdc_googletagmanager/cdc_googletagmanager.php
986 /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php
987 /modules/cdc_googletagmanager/services/CdcTools.php
988 /modules/cdc_googletagmanager/services/PrestashopUtils.php
989 /modules/cdc_googletagmanager/classes/DataLayer.php
990 /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php
991 /modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php
992 /modules/cdc_googletagmanager/services/Gtm_Product.php
993 /modules/cdc_googletagmanager/classes/gtm/Refund.php
994 /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php
995 /modules/cdc_googletagmanager/classes/gtm_ga4/DataLayerItem.php
996 /modules/cdc_googletagmanager/translations/it.php
997 /modules/gremarketing/gremarketing.php
998 /modules/gremarketing/lib/moduleTools.php
999 /modules/gremarketing/translations/it.php
1000 /modules/gremarketing/conf/moduleConfiguration.php
1001 /modules/gremarketing/lib/hook/hookController.php
1002 /modules/gremarketing/lib/hook/hookDisplay.php
1003 /modules/gremarketing/lib/hook/hookBase.php
1004 /modules/gmerchantcenterpro/gmerchantcenterpro.php
1005 /modules/gmerchantcenterpro/translations/it.php
1006 /modules/gmerchantcenterpro/lib/moduleTools.php
1007 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
1008 /modules/gmerchantcenterpro/lib/moduleUpdate.php
1009 /modules/gmerchantcenterpro/lib/install/installController.php
1010 /modules/gmerchantcenterpro/lib/install/installSql.php
1011 /modules/gmerchantcenterpro/lib/install/installInterface.php
1012 /modules/gmerchantcenterpro/models/Feeds.php
1013 /modules/gremarketing/lib/tags/baseDynTag.php
1014 /modules/gremarketing/lib/tags/dynamicCategoryTag.php
1015 /var/cache/dev/smarty/compile/shopwarehouse/2f/9e/ea/2f9eea5170ce390e3df3ef367d69faf4aa1dac49_2.file.header.tpl.php
1016 /modules/connettore/connettore.php
1017 /modules/connettore/configurazione/configurazione_connettore.php
1018 /modules/connettore/classes/AnubiLogger.php
1019 /modules/connettore/classes/AnubiDbPDO.php
1020 /modules/connettore/classes/DbWrapper.php
1021 /modules/connettore/classes/BaseTask.php
1022 /modules/connettore/classes/DbConnettore.php
1023 /modules/connettore/classes/WebHelper.php
1024 /modules/connettore/classes/Utils.php
1025 /modules/connettore/classes/TestataOrdine.php
1026 /modules/connettore/classes/RigaOrdine.php
1027 /modules/connettore/tasks/TestTask.php
1028 /modules/connettore/tasks/ImportazioneDatiTask.php
1029 /modules/connettore/tasks/ImportazioneNuoveCategorieTask.php
1030 /modules/connettore/tasks/AggiornamentoCategorieTask.php
1031 /modules/connettore/tasks/ImportazioneNuoveFunzioniTask.php
1032 /modules/connettore/tasks/ImportazioneNuoviProdottiTask.php
1033 /modules/connettore/tasks/AggiornamentoProdottiTask.php
1034 /modules/connettore/tasks/ImportazioneImmaginiProdottoTask.php
1035 /modules/connettore/tasks/AttivazioneProdottiTask.php
1036 /modules/connettore/tasks/AggiornamentoDisponibilitaTask.php
1037 /modules/connettore/tasks/ImportazioneNuoviManufacturerTask.php
1038 /modules/connettore/tasks/EliminaProdottiCheNonEsistonoTask.php
1039 /modules/connettore/tasks/ImportazioneCorrelatiTask.php
1040 /modules/connettore/tasks/AggiornamentoTagTask.php
1041 /modules/connettore/tasks/AggiornamentoGiacenzeTask.php
1042 /modules/connettore/tasks/IndicizzazioneProdottiTask.php
1043 /modules/connettore/translations/it.php
1044 /modules/feedaty/feedaty.php
1045 /modules/feedaty/translations/it.php
1046 /modules/feedaty/it.php
1047 /modules/feedaty/lib/FeedatyClasses.php
1048 /modules/feedaty/lib/FeedatyWebservice.php
1049 /modules/feedaty/lib/FeedatyPositions.php
1050 /modules/feedaty/lib/FeedatyProtocols.php
1051 /modules/feedaty/lib/FeedatyGenerateElements.php
1052 /modules/feedaty/lib/FeedatyCsvController.php
1053 /modules/tec_dataminimizer/tec_dataminimizer.php
1054 /modules/ec_minorder/ec_minorder.php
1055 /modules/ec_minorder/translations/it.php
1056 /modules/multipleprices/multipleprices.php
1057 /modules/multipleprices/classes/MultiplepricesConfiguration.php
1058 /modules/multipleprices/translations/it.php
1059 /var/cache/dev/smarty/compile/shopwarehouse/1e/5b/1e/1e5b1ed75e7d2edf5948921999bdb0cfc282f073_2.file.styles.tpl.php
1060 /modules/payplug/payplug.php
1061 /modules/payplug/translations/it.php
1062 /modules/payplug/classes/PayPlugDependencies.php
1063 /modules/payplug/classes/DependenciesClass.php
1064 /modules/payplug/src/utilities/validators/accountValidator.php
1065 /modules/payplug/src/utilities/validators/browserValidator.php
1066 /modules/payplug/src/utilities/validators/cardValidator.php
1067 /modules/payplug/src/utilities/validators/lockValidator.php
1068 /modules/payplug/src/utilities/validators/loggerValidator.php
1069 /modules/payplug/src/utilities/validators/moduleValidator.php
1070 /modules/payplug/src/utilities/validators/orderValidator.php
1071 /modules/payplug/src/utilities/validators/paymentValidator.php
1072 /modules/payplug/src/utilities/helpers/AmountHelper.php
1073 /modules/payplug/src/utilities/helpers/ConfigurationHelper.php
1074 /modules/payplug/src/utilities/helpers/CookiesHelper.php
1075 /modules/payplug/src/utilities/helpers/FilesHelper.php
1076 /modules/payplug/src/utilities/helpers/PhoneHelper.php
1077 /modules/payplug/src/utilities/helpers/UserHelper.php
1078 /modules/payplug/src/application/dependencies/PluginInit.php
1079 /modules/payplug/src/application/dependencies/BaseClass.php
1080 /modules/payplug/src/actions/CardAction.php
1081 /modules/payplug/src/actions/CartAction.php
1082 /modules/payplug/src/actions/ConfigurationAction.php
1083 /modules/payplug/src/actions/MerchantTelemetryAction.php
1084 /modules/payplug/src/actions/OnboardingAction.php
1085 /modules/payplug/src/actions/OneyAction.php
1086 /modules/payplug/src/actions/OrderAction.php
1087 /modules/payplug/src/actions/RefundAction.php
1088 /modules/payplug/src/actions/OrderStateAction.php
1089 /modules/payplug/src/actions/PaymentAction.php
1090 /modules/payplug/src/models/entities/CacheEntity.php
1091 /modules/payplug/src/models/entities/OneyEntity.php
1092 /modules/payplug/src/models/entities/PluginEntity.php
1093 /modules/payplug/src/models/entities/OrderStateEntity.php
1094 /modules/payplug/src/application/adapter/AddressAdapter.php
1095 /modules/payplug/src/interfaces/AddressInterface.php
1096 /modules/payplug/src/application/adapter/AssignAdapter.php
1097 /modules/payplug/src/interfaces/AssignInterface.php
1098 /modules/payplug/src/application/adapter/CarrierAdapter.php
1099 /modules/payplug/src/interfaces/CarrierInterface.php
1100 /classes/Carrier.php
1101 /modules/payplug/src/application/adapter/CartAdapter.php
1102 /modules/payplug/src/interfaces/CartInterface.php
1103 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
1104 /modules/payplug/src/interfaces/ConfigurationInterface.php
1105 /modules/payplug/src/application/adapter/ConstantAdapter.php
1106 /modules/payplug/src/interfaces/ConstantInterface.php
1107 /modules/payplug/src/application/adapter/ContextAdapter.php
1108 /modules/payplug/src/interfaces/ContextInterface.php
1109 /modules/payplug/src/application/adapter/CountryAdapter.php
1110 /modules/payplug/src/interfaces/CountryInterface.php
1111 /modules/payplug/src/application/adapter/CurrencyAdapter.php
1112 /modules/payplug/src/interfaces/CurrencyInterface.php
1113 /modules/payplug/src/application/adapter/CustomerAdapter.php
1114 /modules/payplug/src/interfaces/CustomerInterface.php
1115 /modules/payplug/src/application/adapter/DispatcherAdapter.php
1116 /modules/payplug/src/interfaces/DispatcherInterface.php
1117 /modules/payplug/src/application/adapter/LanguageAdapter.php
1118 /modules/payplug/src/interfaces/LanguageInterface.php
1119 /modules/payplug/src/application/adapter/MediaAdapter.php
1120 /modules/payplug/src/interfaces/MediaInterface.php
1121 /modules/payplug/src/application/adapter/MessageAdapter.php
1122 /modules/payplug/src/interfaces/MessageInterface.php
1123 /modules/payplug/src/application/adapter/ModuleAdapter.php
1124 /modules/payplug/src/interfaces/ModuleInterface.php
1125 /modules/payplug/src/application/adapter/OrderAdapter.php
1126 /modules/payplug/src/interfaces/OrderInterface.php
1127 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
1128 /modules/payplug/src/interfaces/OrderHistoryInterface.php
1129 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
1130 /modules/payplug/src/interfaces/OrderSlipInterface.php
1131 /modules/payplug/src/application/adapter/OrderStateAdapter.php
1132 /modules/payplug/src/interfaces/OrderStateInterface.php
1133 /classes/order/OrderState.php
1134 /modules/payplug/src/application/adapter/ProductAdapter.php
1135 /modules/payplug/src/interfaces/ProductInterface.php
1136 /modules/payplug/src/application/adapter/QueryAdapter.php
1137 /modules/payplug/src/interfaces/QueryInterface.php
1138 /modules/payplug/src/application/adapter/ShopAdapter.php
1139 /modules/payplug/src/interfaces/ShopInterface.php
1140 /modules/payplug/src/application/adapter/TabAdapter.php
1141 /modules/payplug/src/interfaces/TabInterface.php
1142 /modules/payplug/src/application/adapter/ToolsAdapter.php
1143 /modules/payplug/src/interfaces/ToolsInterface.php
1144 /modules/payplug/src/application/adapter/TranslationAdapter.php
1145 /modules/payplug/src/interfaces/TranslationInterface.php
1146 /modules/payplug/src/application/adapter/ValidateAdapter.php
1147 /modules/payplug/src/interfaces/ValidateInterface.php
1148 /modules/payplug/src/models/classes/Address.php
1149 /modules/payplug/src/models/classes/ApiRest.php
1150 /modules/payplug/src/models/classes/Configuration.php
1151 /modules/payplug/src/models/classes/Country.php
1152 /modules/payplug/src/models/classes/Order.php
1153 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
1154 /modules/payplug/src/models/classes/Translation.php
1155 /modules/payplug/src/models/repositories/CardRepository.php
1156 /modules/payplug/src/models/repositories/QueryRepository.php
1157 /modules/payplug/src/models/repositories/CacheRepository.php
1158 /modules/payplug/src/models/repositories/CountryRepository.php
1159 /modules/payplug/src/models/repositories/LockRepository.php
1160 /modules/payplug/src/models/repositories/LoggerRepository.php
1161 /modules/payplug/src/models/repositories/ModuleRepository.php
1162 /modules/payplug/src/models/repositories/OrderRepository.php
1163 /modules/payplug/src/models/repositories/OrderStateRepository.php
1164 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
1165 /modules/payplug/src/models/repositories/PaymentRepository.php
1166 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
1167 /modules/payplug/src/models/repositories/ShopRepository.php
1168 /modules/payplug/classes/MyLogPHP.php
1169 /modules/payplug/src/repositories/LoggerRepository.php
1170 /modules/payplug/src/models/entities/LoggerEntity.php
1171 /modules/payplug/src/repositories/TranslationsRepository.php
1172 /modules/payplug/src/repositories/SQLtableRepository.php
1173 /modules/payplug/src/repositories/CacheRepository.php
1174 /modules/payplug/src/repositories/OrderStateRepository.php
1175 /modules/payplug/src/repositories/InstallRepository.php
1176 /modules/payplug/src/utilities/services/API.php
1177 /modules/payplug/src/utilities/services/Browser.php
1178 /modules/payplug/src/utilities/services/Routes.php
1179 /modules/payplug/src/utilities/services/MerchantTelemetry.php
1180 /modules/payplug/classes/ApiClass.php
1181 /modules/payplug/classes/ApplePayClass.php
1182 /modules/payplug/classes/AmountCurrencyClass.php
1183 /modules/payplug/classes/AdminClass.php
1184 /modules/payplug/classes/PayplugLock.php
1185 /modules/payplug/classes/CartClass.php
1186 /modules/payplug/classes/ConfigClass.php
1187 /modules/payplug/classes/InstallmentClass.php
1188 /modules/payplug/classes/HookClass.php
1189 /modules/payplug/classes/MediaClass.php
1190 /modules/payplug/classes/OrderClass.php
1191 /modules/payplug/classes/PaymentClass.php
1192 /modules/payplug/classes/RefundClass.php
1193 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1194 /modules/sendinblue/sendinblue.php
1195 /modules/sendinblue/translations/it.php
1196 /modules/sendinblue/services/ConfigService.php
1197 /modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php
1198 /modules/absfrequentlyboughttogether/class/AbsBuyItWith.php
1199 /modules/absfrequentlyboughttogether/class/AbsPromoFqb.php
1200 /modules/absfrequentlyboughttogether/translations/it.php
1201 /modules/trustedprogramintegration/trustedprogramintegration.php
1202 /modules/trustedprogramintegration/translations/it.php
1203 /src/Core/Product/Search/ProductSearchContext.php
1204 /src/Core/Product/Search/ProductSearchQuery.php
1205 /src/Core/Product/Search/SortOrder.php
1206 /modules/ps_facetedsearch/ps_facetedsearch.php
1207 /modules/ps_facetedsearch/src/HookDispatcher.php
1208 /modules/ps_facetedsearch/src/Hook/Attribute.php
1209 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1210 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1211 /modules/ps_facetedsearch/src/Hook/Category.php
1212 /modules/ps_facetedsearch/src/Hook/Configuration.php
1213 /modules/ps_facetedsearch/src/Hook/Design.php
1214 /modules/ps_facetedsearch/src/Hook/Feature.php
1215 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1216 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1217 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1218 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1219 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1220 /modules/ps_facetedsearch/src/Hook/Product.php
1221 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1222 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1223 /modules/ps_facetedsearch/src/Filters/Provider.php
1224 /modules/ps_facetedsearch/src/URLSerializer.php
1225 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1226 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1227 /src/Core/Product/Search/FacetsRendererInterface.php
1228 /src/Core/Product/Search/ProductSearchProviderInterface.php
1229 /modules/ps_facetedsearch/src/Filters/Converter.php
1230 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1231 /src/Core/Product/Search/ProductSearchResult.php
1232 /modules/ps_facetedsearch/src/Product/Search.php
1233 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1234 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1235 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1236 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1237 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1238 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1239 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1240 /modules/ps_facetedsearch/src/Filters/Products.php
1241 /modules/ps_facetedsearch/src/Filters/Block.php
1242 /modules/ps_facetedsearch/src/Definition/Availability.php
1243 /src/Core/Util/String/StringModifier.php
1244 /src/Core/Util/String/StringModifierInterface.php
1245 /src/Core/Product/Search/Facet.php
1246 /src/Core/Product/Search/Filter.php
1247 /src/Core/Product/Search/FacetCollection.php
1248 /classes/ProductAssembler.php
1249 /classes/ProductPresenterFactory.php
1250 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1251 /src/Adapter/Presenter/Product/ProductPresenter.php
1252 /src/Adapter/Product/ProductColorsRetriever.php
1253 /src/Core/Product/ProductPresentationSettings.php
1254 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1255 /src/Adapter/Presenter/Product/ProductLazyArray.php
1256 /src/Adapter/Presenter/AbstractLazyArray.php
1257 /classes/Image.php
1258 /src/Core/Image/ImageFormatConfiguration.php
1259 /src/Core/Image/ImageFormatConfigurationInterface.php
1260 /classes/FeatureFlag.php
1261 /src/Core/FeatureFlag/FeatureFlagSettings.php
1262 /src/Core/Util/Inflector.php
1263 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1264 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1265 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1266 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1267 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1268 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1269 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1270 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1271 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1272 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1273 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1274 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1275 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1276 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1277 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1278 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1279 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1280 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1281 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1282 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1283 /var/cache/dev/smarty/compile/shopwarehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1284 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1285 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1286 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1287 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1288 /var/cache/dev/smarty/compile/shopwarehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1289 /src/Core/Product/Search/Pagination.php
1290 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f8/11/cb/f811cb95a71b2aadd97e674a0f709876f06d4c42_2.file.category.tpl.php
1291 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1292 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/b2/a5/fe/b2a5fee663562893eda7670099e89eec5d81a1fb_2.file.product-list.tpl.php
1293 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/dd/fe/b9/ddfeb954e222c722253739f7845703c29eaea402_2.file.layout-left-column.tpl.php
1294 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5a/ce/e5/5acee588265771a51ffc84701e00bdd02c9abdf2_2.file.layout-both-columns.tpl.php
1295 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c5/08/43/c508439c1a96a30f9de64446737e6ee1927dfb3b_2.file.helpers.tpl.php
1296 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1297 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/6f/91/236f91d2776e44271e012c43db1c691696c15040_2.file.head.tpl.php
1298 /vendor/smarty/smarty/libs/sysplugins/smarty_undefined_variable.php
1299 /var/cache/dev/smarty/compile/shopwarehouse/27/e9/b0/27e9b031b55351a9f084c5addac17fcde073133e_2.file.gtm_tag.tpl.php
1300 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/fb/db/48/fbdb48daf1e14bbe07fd3699d645f11debb2eb1a_2.file.head-jsonld.tpl.php
1301 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/16/ce/59/16ce59339f787d6cb8ac4f7c0a7f20e99de1b839_2.file.product-list-jsonld.tpl.php
1302 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/0a/0b/4c/0a0b4c89241f913d59419ea9a3612aa6515190d1_2.file.pagination-seo.tpl.php
1303 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1304 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/b9/7c/beb97cb450a9f69fd43c061d99fbdfad7181c6f6_2.file.stylesheets.tpl.php
1305 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ae/4d/30/ae4d30f43146c6e1ffaee0607d30f548b596517f_2.file.javascript.tpl.php
1306 /var/cache/dev/smarty/compile/shopwarehouse/46/35/48/463548647f97f9e2cce954b7188c1f350dab323f_2.file.google_tag_body.tpl.php
1307 /var/cache/dev/smarty/compile/shopwarehouse/5d/db/c8/5ddbc86a06a0a0d6e76e4f9fba4952f2f24c5192_2.file.gtm_tag_noscript.tpl.php
1308 /var/cache/dev/smarty/compile/27/a8/a7/27a8a764939f2f3d8f7490893049eba541e593c2_2.file.view_after_body_opening_tag_header.tpl.php
1309 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/98/20/ef/9820ef0925d3fee40988d8cee22dbe868c6cb068_2.file.product-activation.tpl.php
1310 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/8c/bc/41/8cbc41da8acb85d754b2c50cfefb91ed607a9edf_2.file.header.tpl.php
1311 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e9/b9/d5/e9b9d508f2dd480341846be452ac6f6672284f34_2.file.social-links.tpl.php
1312 /modules/iqitlinksmanager/iqitlinksmanager.php
1313 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1314 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1315 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1316 /modules/iqitlinksmanager/translations/it.php
1317 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1318 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1319 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1320 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/10/displayNav1/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1321 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1322 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1323 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1324 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1325 /modules/iqithtmlandbanners/translations/it.php
1326 /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/10/displayNavCenter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1327 /modules/ps_languageselector/ps_languageselector.php
1328 /modules/ps_currencyselector/ps_currencyselector.php
1329 /var/cache/dev/smarty/compile/shopwarehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1330 /var/cache/dev/smarty/compile/shopwarehouse/a7/b4/2a/a7b42a5e4e0a5166bfca3e9be0e40e49bcdd454f_2.module.iqitcompareviewstemplateshookdisplaynav.tpl.php
1331 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/9a/e8/a0/9ae8a0bf6f8a38863b91cfc212bb6ceb2292b8a7_2.file.header-1.tpl.php
1332 /modules/iqitsearch/iqitsearch.php
1333 /modules/iqitsearch/translations/it.php
1334 /var/cache/dev/smarty/compile/shopwarehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1335 /var/cache/dev/smarty/compile/shopwarehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1336 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/5e/3f/235e3f5ee59d64225af247fb2228e65cd3fe7fb0_2.module.ps_shoppingcartps_shoppingcartdefault.tpl.php
1337 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1338 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1339 /modules/ps_customersignin/ps_customersignin.php
1340 /var/cache/dev/smarty/compile/shopwarehouse/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1341 /modules/pagesnotfound/pagesnotfound.php
1342 /var/cache/dev/smarty/compile/shopwarehouse/63/ba/59/63ba5972c9730522e9fb200398edbc11f4f58089_2.file.feedaty-widget-store.tpl.php
1343 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/10/shopwarehouse/a8/34/6d/a8346d2dc5b79e1534b3385fa0faac4b475b9eb4.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1344 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/1c/e5/92/1ce5928ab8218bc3ddcd60c352dd1d71893f7908_2.file.mobile-header-3.tpl.php
1345 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1346 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1347 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1348 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/62/43/78/624378c7dfeb412830a19d0b0b37a8715548f5cf_2.file.breadcrumb.tpl.php
1349 /modules/iqitproductsnav/iqitproductsnav.php
1350 /modules/iqitproductsnav/translations/it.php
1351 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5e/e2/b8/5ee2b817b44046586c6272340d6af59d1a367ad4_2.file.notifications.tpl.php
1352 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/89/a9/18/89a918329b56f1c800efdd755b39ba9f219ec921_2.file.category-header.tpl.php
1353 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ef/6d/4c/ef6d4c7a880f80029c6b448812468d37383ff042_2.file.category-subcategories.tpl.php
1354 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/26/2c/5e/262c5ee15c17f10153d38421d802f53b3a380c71_2.file.products-top.tpl.php
1355 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1356 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c9/f1/91/c9f191209eb3f477d74071d448cc161f10778b3c_2.file.sort-orders.tpl.php
1357 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c1/47/e9/c147e97b1ab26489e3f10827386d1bcd455d4114_2.file.products.tpl.php
1358 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/b9/de/a6b9dee9c985ceb3eeded4c44440dc98077b6366_2.file.product-list.tpl.php
1359 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/82/b8/3a/82b83aed6eab9dedf4c24a9d0b1f481ebb09cd2c_2.file.product-miniature-thumb.tpl.php
1360 /var/cache/dev/smarty/compile/shopwarehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1361 /vendor/smarty/smarty/libs/plugins/function.math.php
1362 /var/cache/dev/smarty/compile/shopwarehouse/54/50/60/54506057f821234b35c479582bc2dc0b2fc98e35_2.file.artlistproduttori-ps17.tpl.php
1363 /vendor/smarty/smarty/libs/plugins/modifier.date_format.php
1364 /classes/ProductSupplier.php
1365 /var/cache/dev/smarty/compile/shopwarehouse/a9/94/a3/a994a3c5a500481515bc7b0596a4818bfcc60e9d_2.file.text.tpl.php
1366 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e5/37/94/e5379437e7cb07eac35c6b76d06b8bbdd09277e9_2.file.product-miniature-btn.tpl.php
1367 /var/cache/dev/smarty/compile/shopwarehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1368 /var/cache/dev/smarty/compile/shopwarehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
1369 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/4d/f5/a64df5b4b109264f55bc8c441b2ddd649e00fe0b_2.file.pagination.tpl.php
1370 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7d/c7/b9/7dc7b920724d67c85c9a1148ffc6e1352c81c741_2.file.products-bottom.tpl.php
1371 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1372 /var/cache/dev/smarty/compile/shopwarehouse/85/b4/27/85b427a04c9571c52bce3e03ca48c19c59f0ab89_2.file.related_posts_category.tpl.cache.php
1373 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1374 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1375 /var/cache/dev/smarty/cache/ybc_blog/8086/1/1/1/10/240508/shopwarehouse/ce/42/62/ce4262669d57a99fd312a58083a030ff04f2f417.related_posts_category.tpl.php
1376 /modules/ps_categorytree/ps_categorytree.php
1377 /var/cache/dev/smarty/compile/shopwarehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1378 /var/cache/dev/smarty/compile/shopwarehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1379 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/31/e3/1e/31e31e2f9e0e15e082e36c94e3ce506f8b52318b_2.file.footer.tpl.php
1380 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/59/d8/c5/59d8c5b4bd8f7dc7e77b4b784cf989309f96e9a6_2.file.footer-2.tpl.php
1381 /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/10/displayFooter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1382 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/10/displayFooter/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1383 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/10/shopwarehouse/31/45/63/3145630ee48f34c64dce20915cd36a7d798fa52b.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1384 /var/cache/dev/smarty/compile/shopwarehouse/59/fa/4a/59fa4a468746e7397894d4d55728b7a0399415fc_2.file.artinvoice_js.tpl.php
1385 /var/cache/dev/smarty/compile/shopwarehouse/c8/59/18/c85918ff6d9da0aabb89af560f45f255349ce95e_2.file.footer.tpl.php
1386 /modules/lgcookieslaw/classes/LGCookiesLawCookie.php
1387 /classes/CMS.php
1388 /var/cache/dev/smarty/compile/b1/74/ee/b174ee22d35566f04bb92c3cdb14885c864f06e9_2.file.view_banner.tpl.php
1389 /var/cache/dev/smarty/compile/shopwarehouse/76/b6/77/76b677d100d34eed3ff7a027ae76cd2d2caafd5f_2.file.shinystat.tpl.php
1390 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f3/e2/01/f3e201110b395deed6ef05594261db3284242b23_2.file.footer-copyrights-1.tpl.php
1391 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d2/ed/33/d2ed337060b8ed3aaacc807eb44ca9f06bc7740c_2.file.password-policy-template.tpl.php
1392 /classes/form/CustomerLoginForm.php
1393 /classes/form/AbstractForm.php
1394 /classes/form/FormInterface.php
1395 /src/Core/Foundation/Templating/RenderableInterface.php
1396 /classes/form/CustomerLoginFormatter.php
1397 /classes/form/FormFormatterInterface.php
1398 /classes/ValidateConstraintTranslator.php
1399 /src/Core/Util/InternationalizedDomainNameConverter.php
1400 /src/Core/Foundation/Templating/RenderableProxy.php
1401 /var/cache/dev/smarty/compile/shopwarehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1402 /classes/form/FormField.php
1403 /var/cache/dev/smarty/compile/shopwarehouse/22/1c/83/221c831891cf43068d82e5d2cedfd7083701554e_2.file.login-form.tpl.php
1404 /var/cache/dev/smarty/compile/shopwarehouse/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1405 /var/cache/dev/smarty/compile/8f/74/7a/8f747aa7caf4a60dae1415d8fc15828b2e6a2977_2.file.form-fields.tpl.php
1406 /var/cache/dev/smarty/compile/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1407 /var/cache/dev/smarty/compile/shopwarehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1408 /modules/statsdata/statsdata.php
1409 /classes/Guest.php
1410 /classes/Connection.php
1411 /classes/Page.php
1412 /classes/ConnectionsSource.php