armor

prodotto aggiunto alla lista
Prodotto aggiunto per il confronto.
Load Time 1765 ms
Querying Time 1399 ms
Queries 1207
Memory Peak Usage 36.1 Mb
Included Files 1369 files - 17.74 Mb
PrestaShop Cache - Mb
Global vars 1.39 Mb
PrestaShop Version 8.1.5
PHP Version 8.1.28
MySQL Version 10.1.48-MariaDB-0ubuntu0.18.04.1
Memory Limit 1024M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 9.824 ms 9.824 ms 5.94 Mb 6.7 Mb
__construct 0.015 ms 9.839 ms - Mb 6.7 Mb
init 28.009 ms 37.848 ms 1.26 Mb 7.6 Mb
checkAccess 0.003 ms 37.851 ms - Mb 7.6 Mb
setMedia 16.221 ms 54.072 ms 0.71 Mb 8.1 Mb
postProcess 0.002 ms 54.074 ms - Mb 8.1 Mb
initHeader 0.001 ms 54.075 ms - Mb 8.1 Mb
initContent 1422 ms 1476 ms 13.13 Mb 26.6 Mb
initFooter 0.002 ms 1476 ms - Mb 26.6 Mb
display 288.256 ms 1765 ms 13.65 Mb 36.1 Mb
Hook Time Memory Usage
DisplayHeader 223.537 ms 7.52 Mb
DisplayProductPriceBlock 95.844 ms 5.76 Mb
DisplayAfterTitleTag 52.031 ms 2.18 Mb
ActionFrontControllerSetMedia 14.553 ms 0.60 Mb
DisplayBeforeBodyClosingTag 14.336 ms 0.17 Mb
displayProductListReviews 9.903 ms 0.40 Mb
displayProductListFunctionalButtons 6.711 ms 0.03 Mb
DisplayFooter 5.562 ms 0.37 Mb
DisplayProductListReviews 5.276 ms - Mb
displayBeforeBodyClosingTag 4.019 ms 0.51 Mb
DisplayTop 3.466 ms 0.16 Mb
displayNav2 2.976 ms 0.21 Mb
renderWidget 2.840 ms 0.14 Mb
displayLeftColumn 1.867 ms 0.08 Mb
Header 1.862 ms 0.15 Mb
displayMainMenu 1.703 ms 0.85 Mb
displayCategoryElementor 1.548 ms 0.08 Mb
displayNav1 1.545 ms 0.09 Mb
displayFooter 1.085 ms 0.11 Mb
displayNavCenter 0.985 ms 0.06 Mb
DisplayAfterBodyOpeningTag 0.805 ms 0.04 Mb
displayAfterBreadcrumb 0.749 ms 0.04 Mb
DisplayLeftColumn 0.660 ms 0.19 Mb
IsJustElementor 0.487 ms 0.02 Mb
DisplayFooterCategory 0.472 ms 0.02 Mb
ProductSearchProvider 0.319 ms 0.01 Mb
DisplayFooterAfter 0.233 ms 0.01 Mb
ModuleRoutes 0.062 ms 0.03 Mb
OverrideLayoutTemplate 0.057 ms - Mb
ActionFrontControllerInitAfter 0.013 ms - Mb
ActionDispatcher 0.010 ms - Mb
displayVerticalMenu 0.009 ms - Mb
ActionProductSearchAfter 0.008 ms - Mb
DisplayFooterBefore 0.007 ms - Mb
34 hook(s) 455.541 ms 19.78 Mb
Module Time Memory Usage
doofinder 9.510 ms 1.72 Mb
ybc_blog 7.341 ms 0.54 Mb
simpleimportproduct 5.205 ms 0.35 Mb
ets_abandonedcart 2.231 ms 0.17 Mb
iqitthemeeditor 1.000 ms 0.26 Mb
ps_emailsubscription 0.650 ms 0.01 Mb
ps_emailalerts 0.237 ms 0.01 Mb
ps_checkout 14.252 ms 0.50 Mb
ps_accounts 0.504 ms - Mb
psrecaptcha 0.549 ms 0.17 Mb
revsliderprestashop 1.271 ms 0.03 Mb
arteinvoice 0.439 ms 0.03 Mb
lgcookieslaw 8.372 ms 0.55 Mb
ps_shoppingcart 0.159 ms 0.01 Mb
productcomments 0.162 ms 0.01 Mb
iqitcompare 4.520 ms 0.08 Mb
iqitcontactpage 0.802 ms 0.07 Mb
iqitcountdown 0.269 ms 0.01 Mb
iqitelementor 2.531 ms 0.11 Mb
iqitfreedeliverycount 0.206 ms 0.01 Mb
iqitmegamenu 2.013 ms 0.86 Mb
iqitreviews 10.087 ms 0.42 Mb
iqitwishlist 8.850 ms 0.58 Mb
iqitextendedproduct 0.259 ms 0.01 Mb
artproduttori 5.503 ms - Mb
ganalyticspro 196.586 ms 6.36 Mb
shinystat 0.529 ms 0.02 Mb
ets_integrategooglemarketing 0.829 ms 0.10 Mb
cdc_googletagmanager 53.016 ms 2.25 Mb
gremarketing 16.766 ms 0.56 Mb
gmerchantcenterpro 8.051 ms 0.39 Mb
connettore 0.769 ms 0.01 Mb
feedaty 5.395 ms 0.16 Mb
tec_dataminimizer 0.270 ms 0.01 Mb
ec_minorder 0.328 ms 0.01 Mb
multipleprices 82.771 ms 4.80 Mb
payplug 19.860 ms 1.25 Mb
sendinblue 0.613 ms 0.01 Mb
absfrequentlyboughttogether 0.529 ms 0.07 Mb
trustedprogramintegration 0.243 ms 0.01 Mb
ps_facetedsearch 1.223 ms 0.22 Mb
iqitlinksmanager 2.349 ms 0.13 Mb
iqithtmlandbanners 1.790 ms 0.08 Mb
ps_languageselector 0.804 ms 0.05 Mb
ps_currencyselector 0.570 ms 0.05 Mb
iqitsearch 2.002 ms 0.05 Mb
ps_customersignin 1.447 ms 0.08 Mb
pagesnotfound 0.102 ms 0.01 Mb
iqitproductsnav 1.229 ms 0.04 Mb
ps_categorytree 2.017 ms 0.09 Mb
statsdata 14.134 ms 0.17 Mb
51 module(s) 501.145 ms 23.42 Mb

Stopwatch SQL - 1207 queries

# Query Time (ms) Rows Filesort Group By Location
807
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 535 ORDER BY vl.`value` ASC
64.040 ms 6500 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
805
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 534 ORDER BY vl.`value` ASC
54.028 ms 974 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
562
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
28.164 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
1078
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (54724) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
23.931 ms 1 Yes Yes /classes/Product.php:4520
957
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
18.690 ms 1 /classes/Category.php:1591
804
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=534)) GROUP BY fp.id_feature_value
16.496 ms 39726720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
778
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=508)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
14.296 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
644
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=371)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
13.595 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
563
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=283)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
13.105 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
554
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179)))
11.660 ms 14450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
830
REPLACE INTO uag_layered_filter_block (hash, data) VALUES ("47360a2b19910f3f6c0e63166236abef", "a:1:{s:7:\"filters\";a:9:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:9:\"Categorie\";s:6:\"values\";a:2:{i:8346;a:2:{s:4:\"name\";s:7:\"ink-jet\";s:3:\"nbr\";i:7;}i:8347;a:2:{s:4:\"name\";s:17:\"toner ricostruiti\";s:3:\"nbr\";i:3;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilità\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:12:\"In magazzino\";s:3:\"nbr\";i:3;}i:0;a:2:{s:4:\"name\";s:15:\"Non disponibile\";s:3:\"nbr\";i:7;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:1:{i:28520;a:2:{s:4:\"name\";s:5:\"Armor\";s:3:\"nbr\";i:10;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:3;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Prezzo\";s:3:\"max\";d:73;s:3:\"min\";d:3;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:10;s:5:\"value\";N;}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:280;s:6:\"values\";a:4:{i:10410;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:5:\"Ciano\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:91;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:6:\"Giallo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1134;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:7:\"Magenta\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:26;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:4:\"Nero\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Colore\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:282;s:6:\"values\";a:2:{i:10186;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:9:\"Cartuccia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10191;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:5:\"Toner\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Tipologia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:6;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:533;s:6:\"values\";a:1:{i:10187;a:4:{s:3:\"nbr\";i:10;s:4:\"name\";s:11:\"Compatibile\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:21:\"Originale/compatibile\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:7;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:534;s:6:\"values\";a:120:{i:10390;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"1,200pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10843;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"1.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11209;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:8:\"1.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11118;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"1.200 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10371;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"1.250pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10292;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"1.300 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10975;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"1.300pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10838;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"1.400 PAG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10973;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"1.400pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10721;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"1.500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13124;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"1.600 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:66967;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:14:\"1.600 pag cad.\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10289;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"2.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10340;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"2.200 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11022;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"2.200pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10855;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"2.300 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11028;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"2.300pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10306;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"2.500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11172;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:8:\"2.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10833;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"2.600 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11026;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"2.800pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10392;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:9:\"3.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11179;a:5:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"3.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:13108;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"4.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10398;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"5.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10413;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:6:\"6,5 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11051;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:8:\"6.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13737;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"6.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10862;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"7.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63910;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"7.5ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13578;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"7.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10415;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:6:\"8,5 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10312;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"8.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:14206;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"8.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10412;a:4:{s:3:\"nbr\";i:8;s:4:\"name\";s:4:\"9 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10417;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:6:\"9,5 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10420;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"9,5ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10385;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"9.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13763;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:8:\"9.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10373;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"9.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10409;a:5:{s:3:\"nbr\";i:7;s:4:\"name\";s:5:\"10 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:10411;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:7:\"10,5 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10394;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:9:\"10.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10931;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"11.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11301;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:4:\"11ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10416;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"12 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10591;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"12.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10983;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:9:\"12.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10223;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"13.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13699;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"13.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10407;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:5:\"14 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10414;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"15 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10400;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"15.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11694;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"15.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11394;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"15ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63929;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"16,5ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13718;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"16.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10405;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"17 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13759;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"17.500pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10408;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:5:\"18 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10597;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"18.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63940;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:6:\"19,5ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10396;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"20.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10961;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"20.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10402;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:5:\"21 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10403;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:5:\"22 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:17066;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"22ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11255;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"24.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10933;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"25.000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11227;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"25.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:17147;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:4:\"26ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10406;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:5:\"28 ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:17189;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"32ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:11613;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"36ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:13070;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"40.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63969;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:4:\"43ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63938;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"45,5ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10923;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"50.000pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:12860;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"53ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:63963;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:4:\"77ml\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10249;a:4:{s:3:\"nbr\";i:13;s:4:\"name\";s:8:\"1000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10284;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"1200 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10295;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"1300 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10237;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:8:\"1400 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10230;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:8:\"1500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10314;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"1500PG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10273;a:5:{s:3:\"nbr\";i:2;s:4:\"name\";s:8:\"1600 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:10327;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:8:\"1800 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10329;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"1800PG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10198;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:8:\"2000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10276;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:8:\"2100 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10235;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:8:\"2200 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10245;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:8:\"2300 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10325;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"2400 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10194;a:4:{s:3:\"nbr\";i:8;s:4:\"name\";s:8:\"2500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10297;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:8:\"2600 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10320;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"2700 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10254;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"2800 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10227;a:4:{s:3:\"nbr\";i:8;s:4:\"name\";s:8:\"3000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10260;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"3000PG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10377;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"3100 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10212;a:4:{s:3:\"nbr\";i:9;s:4:\"name\";s:8:\"3500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10214;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"3500PG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10196;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:8:\"4000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10192;a:4:{s:3:\"nbr\";i:8;s:4:\"name\";s:8:\"5000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10203;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:8:\"6000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10210;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:8:\"6500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10200;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"6700 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10322;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"6900 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10218;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"7000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10225;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"7200 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10258;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"8000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10379;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:8:\"9000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10241;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"10000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10365;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"10500 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10233;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"12000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10268;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"14000PG\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10263;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"18000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10282;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"20000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10310;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"24000 pag\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Durata\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:8;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:535;s:6:\"values\";a:2:{i:10324;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"CF210A\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:10274;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"EP-725\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:8:\"Cod. OEM\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}}}")
11.246 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
633
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=358)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
10.762 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `uag_lang` l
JOIN uag_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
10.272 ms 1 /classes/Language.php:1216
544
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 534 ORDER BY vl.`value` ASC
10.043 ms 974 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
741
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=471)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
8.446 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
631
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=356)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
8.363 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
590
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=312)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
8.081 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
579
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=301)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
8.008 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
828
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=560)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
7.892 ms 20400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
713
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=443)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
7.753 ms 13600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
627
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=352)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
7.689 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
628
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=353)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
7.607 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
548
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179)))
6.983 ms 14450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
636
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=361)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
6.961 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
632
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=357)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
6.850 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
764
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=494)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
6.743 ms 57120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `uag_configuration` c
LEFT JOIN `uag_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
6.232 ms 2108 /classes/Configuration.php:180
1205
INSERT INTO `uag_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('843', '52', '51145964', '', '1', '1', '2024-05-08 14:24:59')
5.807 ms 1 /classes/ObjectModel.php:622
537
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7928 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
5.729 ms 472 /classes/Category.php:1062
595
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=318)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.566 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1011
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 1241 AND c.`nright` >= 1246 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
5.378 ms 97 Yes /classes/Category.php:1600
708
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=437)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.254 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
685
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=414)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.135 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
802
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=533)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.084 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
623
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=348)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.024 ms 61200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
577
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=299)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
5.023 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
570
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=292)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.982 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
551
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND cg.id_group='1' AND c.level_depth<=5 AND c.nleft>1241 AND c.nright<1246 GROUP BY cp.id_category
4.971 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
610
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=335)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.903 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1064
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (45824) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
4.900 ms 1 Yes Yes /classes/Product.php:4520
642
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=369)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.840 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
585
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=307)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.605 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
575
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=297)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.582 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
547
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC LIMIT 0, 24
4.563 ms 7225 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1201
INSERT INTO `uag_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
4.559 ms 1 /classes/ObjectModel.php:622
587
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=309)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.550 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
569
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=291)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.537 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
552
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (10409, 10273, 11179)))
4.528 ms 14450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
675
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=403)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.520 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
638
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=363)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.471 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
614
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=339)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.467 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
678
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=407)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.454 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
637
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=362)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.388 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
50
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
4.300 ms 3 /classes/CartRule.php:357
645
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=372)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.244 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
592
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=315)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.238 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
654
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=382)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.235 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
630
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=355)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.219 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
573
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=295)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.213 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
589
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=311)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.173 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
619
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=344)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.173 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
555
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `uag_manufacturer` m INNER JOIN uag_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `uag_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
4.166 ms 738 Yes /classes/Manufacturer.php:211
1060
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 25510 LIMIT 1
4.141 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
586
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=308)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.137 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
553
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179)))
4.134 ms 14450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
567
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=289)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.121 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
640
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=367)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.120 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
629
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=354)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.117 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
559
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 280 ORDER BY vl.`value` ASC
4.105 ms 507 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
626
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=351)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.091 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
692
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=421)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.078 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
599
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=323)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.077 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
625
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=350)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.076 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
600
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=324)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.074 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
584
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=306)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.066 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
653
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=380)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.053 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
769
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=499)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.043 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
580
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=302)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.036 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
578
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=300)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.033 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
596
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=319)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
4.033 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
571
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=293)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.995 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
581
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=303)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.967 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
582
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=304)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.966 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
564
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=284)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.949 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
550
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
3.944 ms 718 Yes /classes/Category.php:724
620
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=345)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.922 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
588
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=310)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.907 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
759
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=489)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.862 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
747
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=477)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.847 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
639
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=366)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.843 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
566
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=288)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.829 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
812
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=540)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.811 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
603
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=327)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.782 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
652
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=379)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.779 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
568
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=290)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.778 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
560
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=281)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.757 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1118
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
3.753 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
806
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=535)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.747 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
634
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=359)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.744 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
655
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=383)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.733 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
576
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=298)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.729 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
583
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=305)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.723 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
666
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=394)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.696 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
770
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=500)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.691 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
622
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=347)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.689 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
447
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25476) LIMIT 1
3.667 ms 1 /src/Adapter/EntityMapper.php:71
799
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=529)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.635 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
607
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=332)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.629 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
487
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45803) LIMIT 1
3.627 ms 1 /src/Adapter/EntityMapper.php:71
646
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=373)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.626 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
779
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=509)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.624 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
561
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=282)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.590 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
609
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=334)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.589 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
543
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `uag_feature` f  INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `uag_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
3.579 ms 280 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
605
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=329)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.575 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
300
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25478 LIMIT 1
3.569 ms 1 /classes/SpecificPrice.php:435
656
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=384)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.569 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
707
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=436)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.564 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
746
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=476)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.557 ms 80240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
760
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=490)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.553 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
743
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=473)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.532 ms 55760 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
647
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=374)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.528 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
615
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=340)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.505 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
46
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_accounts" LIMIT 1
3.499 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
558
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=280)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.468 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
683
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=412)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.406 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
710
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=439)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.361 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
480
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45802 AND `id_shop` = 1
3.320 ms 1 /src/Adapter/EntityMapper.php:79
1128
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
3.314 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
684
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=413)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.279 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
65
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7928 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
3.270 ms 472 /classes/Category.php:1062
556
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) GROUP BY p.id_manufacturer
3.269 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
481
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 45802
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
3.263 ms 0 /classes/Product.php:1732
752
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=482)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.227 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
716
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=446)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.216 ms 58480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
753
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=483)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.214 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
731
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=461)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.213 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
958
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 1241 AND c.`nright` >= 1246 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
3.186 ms 97 Yes /classes/Category.php:1600
1080
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54724)
GROUP BY a0.`id_supplier`
3.156 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
658
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=386)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.138 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
635
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=360)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.130 ms 36720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
565
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=287)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.119 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
704
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=433)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.104 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
661
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=389)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.063 ms 31280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
668
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=396)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.058 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
702
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=431)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.028 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
701
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=430)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.027 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
700
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=429)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
3.001 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
780
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=510)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.991 ms 50320 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
732
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=462)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.978 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
500
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25478) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
2.923 ms 1 /classes/stock/StockAvailable.php:778
705
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=434)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.910 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
754
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=484)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.903 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
771
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=501)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.875 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
928
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25510
ORDER BY `position`
2.853 ms 1 Yes /classes/Product.php:3545
791
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=521)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.841 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
772
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=502)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.834 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
748
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=478)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.729 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
745
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=475)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.723 ms 47600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
755
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=485)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.715 ms 14450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
784
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=514)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.692 ms 51680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
826
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=554)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.629 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
482
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45802 LIMIT 1
2.617 ms 1 /classes/Product.php:1106
74
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `uag_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `uag_hook_alias` ha
INNER JOIN `uag_hook` h ON ha.name = h.name
2.546 ms 0 /classes/Hook.php:1292
800
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=530)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.516 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `uag_module` m
INNER JOIN uag_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `uag_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `uag_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `uag_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
2.462 ms 200 Yes Yes /classes/Hook.php:1233
1120
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (56685) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
2.394 ms 1 Yes Yes /classes/Product.php:4520
624
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=349)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.361 ms 85680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
823
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=551)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.314 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
75
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `uag_hook_module` hm
STRAIGHT_JOIN `uag_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `uag_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.292 ms 645 /classes/Hook.php:456
744
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=474)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.284 ms 44880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
616
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=341)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.274 ms 44880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
328
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 57073
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
2.209 ms 0 /classes/Product.php:1732
715
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=445)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.199 ms 16320 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
824
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=552)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.160 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
763
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=493)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.124 ms 34000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
47
SELECT SQL_NO_CACHE 1 FROM uag_cart_product cp INNER JOIN uag_product p
ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
2.105 ms 1 /classes/Cart.php:4210
742
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=472)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.069 ms 59840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
714
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=444)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
2.045 ms 78880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
44
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8346) AND (b.`id_shop` = 1) LIMIT 1
2.017 ms 1 /src/Adapter/EntityMapper.php:71
557
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM uag_product p INNER JOIN uag_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246
1.966 ms 85 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
643
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=370)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.943 ms 43520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
785
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=515)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.893 ms 47600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
717
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=447)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.887 ms 14960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
829
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=561)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.813 ms 9520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
23
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*
FROM `uag_feature` f
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1)
ORDER BY f.`position` ASC
1.779 ms 280 Yes /classes/Feature.php:92
591
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=314)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.764 ms 85680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
679
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=408)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.761 ms 57120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
648
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=375)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.753 ms 27200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
233
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25475 LIMIT 1
1.751 ms 1 /classes/SpecificPrice.php:435
709
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=438)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.748 ms 32640 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1079
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54724 LIMIT 1
1.741 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
825
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=553)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.729 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
765
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=495)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.717 ms 55760 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
641
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=368)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.714 ms 35360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
593
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=316)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.711 ms 73440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
945
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 57043
1.699 ms 1 /classes/Product.php:2902
469
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 45800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.668 ms 1 /classes/stock/StockAvailable.php:753
574
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=296)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.661 ms 70720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
649
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=376)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.656 ms 68000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
681
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=410)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.654 ms 70720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
608
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=333)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.646 ms 65280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
597
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=320)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.628 ms 62560 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
694
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=423)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.592 ms 63920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
808
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=536)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.589 ms 44880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
572
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=294)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.584 ms 53040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
650
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=377)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.576 ms 81600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
766
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=496)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.563 ms 54400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
936
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 54724
1.562 ms 1 /classes/Product.php:2902
1109
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
1.561 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
821
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=549)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.542 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
782
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=512)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.540 ms 24480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
721
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=451)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.537 ms 40800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
687
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=416)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.536 ms 35360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
948
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 67889) AND (b.`id_shop` = 1) LIMIT 1
1.527 ms 1 /src/Adapter/EntityMapper.php:71
665
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=393)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.526 ms 24480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
761
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=491)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.520 ms 19040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
612
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=337)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.509 ms 28560 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
606
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=330)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.495 ms 16320 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
820
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=548)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.491 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
813
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=541)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.488 ms 32640 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
617
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=342)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.472 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
598
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=322)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.465 ms 81600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
231
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
1.449 ms 1 /classes/Product.php:5655
604
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=328)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.441 ms 61200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
664
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=392)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.431 ms 39440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
944
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 57043
ORDER BY `position`
1.417 ms 1 Yes /classes/Product.php:3545
801
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=532)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.414 ms 19040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
611
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=336)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.413 ms 24480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
594
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=317)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.403 ms 62560 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
682
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=411)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.400 ms 66640 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
719
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=449)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.396 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
693
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=422)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.389 ms 20400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
822
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=550)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.389 ms 8160 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
777
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=507)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.389 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
680
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=409)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.386 ms 20400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
621
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=346)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.383 ms 70720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
676
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=405)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.382 ms 46240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
723
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=453)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.381 ms 29920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
686
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=415)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.374 ms 32640 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
768
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=498)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.370 ms 23120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
667
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=395)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.366 ms 20400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
601
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=325)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.366 ms 12240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
811
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=539)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.360 ms 44880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
728
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=458)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.358 ms 32640 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
809
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=537)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.350 ms 47600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
722
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=452)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.341 ms 29920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM uag_shop_url su
LEFT JOIN uag_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.angoloufficio.it' OR su.domain_ssl = 'www.angoloufficio.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
1.340 ms 1 Yes /classes/shop/Shop.php:1364
738
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=468)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.335 ms 43520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
677
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=406)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.330 ms 48960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
762
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=492)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.320 ms 65280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
662
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=390)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.318 ms 17680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
818
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=546)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.318 ms 85680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
727
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=457)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.302 ms 29920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
718
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=448)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.297 ms 21760 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
613
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=338)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.291 ms 34000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
720
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=450)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.289 ms 63920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
672
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=400)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.277 ms 31280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
795
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=525)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.263 ms 14960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
817
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=545)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.259 ms 80240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
689
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=418)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.254 ms 27200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
697
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=426)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.253 ms 62560 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
767
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=497)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.252 ms 43520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
706
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=435)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.250 ms 25840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
690
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=419)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.240 ms 42160 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
43
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `uag_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 7928
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.234 ms 2 Yes Yes /classes/Category.php:924
696
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=425)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.234 ms 19040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
663
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=391)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.233 ms 24480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
792
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=522)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.233 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
827
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=555)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.232 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
794
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=524)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.220 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
659
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=387)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.218 ms 42160 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25475
AND image_shop.`cover` = 1 LIMIT 1
1.216 ms 1 /classes/Product.php:3570
1114
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
1.213 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1148
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (60901) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.208 ms 1 Yes Yes /classes/Product.php:4520
814
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=542)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.208 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
660
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=388)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.207 ms 34000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
602
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=326)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.199 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
783
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=513)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.199 ms 47600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
781
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=511)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.197 ms 23120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
819
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=547)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.196 ms 17680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
724
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=454)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.186 ms 43520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
810
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=538)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.185 ms 48960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
674
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=402)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.176 ms 31280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
651
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=378)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.169 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
711
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=440)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.167 ms 34000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
671
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=399)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.164 ms 63920 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
796
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=526)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.163 ms 8160 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
831
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-05-08 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM uag_product p
LEFT JOIN uag_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN uag_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN uag_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (25510,45824,54724,54725,54726,56685,57043,60901,67889,68236)
1.155 ms 10 /classes/ProductAssembler.php:95
1132
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
1.154 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
712
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=441)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.153 ms 36720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
740
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=470)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.132 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
733
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=463)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.126 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
688
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=417)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.111 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
726
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=456)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.108 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
758
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=488)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.108 ms 12240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
669
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=397)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.107 ms 10880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
749
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=479)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.103 ms 17680 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `uag_hook` h
WHERE (h.active = 1)
1.098 ms 1128 /classes/Hook.php:1332
1127
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 56685)
GROUP BY a0.`id_supplier`
1.096 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
739
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=469)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.093 ms 68000 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
797
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=527)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.092 ms 12240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
751
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=481)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.089 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
618
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=343)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.083 ms 6800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
730
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=460)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.076 ms 24480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
798
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=528)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.074 ms 6800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
750
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=480)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.070 ms 23120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
725
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=455)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.069 ms 12240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
803
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 533 ORDER BY vl.`value` ASC
1.067 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
787
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=517)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.054 ms 38080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
691
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=420)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.052 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
790
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=520)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.049 ms 44880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
756
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=486)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.048 ms 19040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1206
INSERT INTO `uag_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('652', '', 'www.angoloufficio.it/7928-armor?q=Durata-3.000pag-1600+pag-10+ml', '', '2024-05-08 14:24:59')
1.047 ms 1 /classes/ObjectModel.php:622
1063
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 45824 LIMIT 1
1.041 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
703
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=432)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.034 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
816
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=544)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.026 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
525
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1)
1.023 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:91
737
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=467)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.022 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
789
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=519)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.015 ms 23120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
815
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=543)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
1.010 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
859
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 54724
ORDER BY f.position ASC
1.003 ms 4 Yes /classes/Product.php:6015
516
SHOW TABLES LIKE "uag_gmcp_1800"
1.000 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
342
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 56811) LIMIT 1
0.993 ms 1 /src/Adapter/EntityMapper.php:71
657
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=385)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.987 ms 6800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
735
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=465)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.985 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
729
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=459)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.975 ms 9520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
734
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=464)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.967 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
542
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM uag_layered_category
WHERE controller = 'category'
AND id_category = 7928
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.962 ms 270 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
786
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=516)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.952 ms 36720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
793
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=523)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.951 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
757
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=487)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.949 ms 12240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
215
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25473 AND id_shop=1 LIMIT 1
0.945 ms 1 /classes/Product.php:6870
673
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=401)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.944 ms 20400 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
193
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25472) AND (b.`id_shop` = 1) LIMIT 1
0.942 ms 1 /src/Adapter/EntityMapper.php:71
695
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=424)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.936 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
773
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=503)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.928 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
788
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=518)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.927 ms 36720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
736
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=466)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.923 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
941
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 56685) AND (b.`id_shop` = 1) LIMIT 1
0.920 ms 1 /src/Adapter/EntityMapper.php:71
670
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=398)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.918 ms 10880 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM uag_shop_group gs
LEFT JOIN uag_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN uag_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.918 ms 1 Yes /classes/shop/Shop.php:715
450
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25476 LIMIT 1
0.907 ms 1 /classes/Product.php:1106
774
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=504)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.892 ms 2720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1086
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.889 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
698
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=427)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.887 ms 4080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
699
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=428)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.878 ms 5440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
849
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45824 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45824 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.858 ms 0 /classes/Cart.php:1423
775
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=505)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.854 ms 1360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
776
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (10409, 10273, 11179))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=1241 AND c.nright<=1246 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=506)) AND ((fp_1.id_feature_value IN (10409, 10273, 11179))) GROUP BY fp.id_feature_value
0.854 ms 8160 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
199
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25472 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25472 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.826 ms 0 /classes/Cart.php:1423
208
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45799 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45799 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.796 ms 0 /classes/Cart.php:1423
189
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25471 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25471 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.787 ms 0 /classes/Cart.php:1423
510
SELECT SQL_NO_CACHE ac.id_ets_abancart_campaign
FROM `uag_ets_abancart_campaign` ac
LEFT JOIN `uag_ets_abancart_campaign_country` `cc` ON cc.id_ets_abancart_campaign = ac.id_ets_abancart_campaign
LEFT JOIN `uag_ets_abancart_campaign_with_lang` `cl` ON cl.id_ets_abancart_campaign = ac.id_ets_abancart_campaign AND cl.id_lang=1
LEFT JOIN `uag_ets_abancart_campaign_group` `acg` ON ac.id_ets_abancart_campaign = acg.id_ets_abancart_campaign
LEFT JOIN `uag_group_shop` `gs` ON gs.id_group = acg.id_group AND gs.id_shop = 1
WHERE (ac.id_shop = 1) AND (ac.enabled = 1 AND ac.deleted = 0) AND (IF(ac.is_all_lang != 1, cl.id_ets_abancart_campaign is NOT NULL AND cl.id_lang=1, 1)) AND (ac.campaign_type != 'email') AND (ac.campaign_type != 'customer') AND (IF(ac.min_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.min_total_cart <= 0, 1) AND IF(ac.max_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.max_total_cart >= 0, 1)) AND (IF(ac.available_from is NOT NULL, ac.available_from <= '2024-05-08', 1) AND IF(ac.available_to is NOT NULL, ac.available_to >= '2024-05-08', 1)) AND (IF(ac.has_applied_voucher = 'both' OR (ac.has_applied_voucher = 'yes' AND 0 > 0) OR (ac.has_applied_voucher = 'no' AND 0 = 0), 1, 0)) AND (IF(ac.has_product_in_cart = 1, 0, 1)) AND (acg.id_group = 1) AND (ac.is_all_country = 1 OR cc.id_country = -1 OR cc.id_country=10)
GROUP BY ac.id_ets_abancart_campaign
0.779 ms 1 Yes /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:407
1191
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `uag_category` c
INNER JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `uag_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 8
AND nleft >= 1241 AND nright <= 1246
AND c.id_category IN (
SELECT id_category
FROM `uag_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cl.`name` ASC
0.779 ms 96 Yes /modules/ps_categorytree/ps_categorytree.php:166
1107
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54726 LIMIT 1
0.776 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
934
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54724) AND (b.`id_shop` = 1) LIMIT 1
0.752 ms 1 /src/Adapter/EntityMapper.php:71
48
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.742 ms 3 /classes/CartRule.php:357
229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25474
ORDER BY f.position ASC
0.742 ms 5 Yes /classes/Product.php:6015
232
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25475) AND (b.`id_shop` = 1) LIMIT 1
0.709 ms 1 /src/Adapter/EntityMapper.php:71
1133
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 57043 LIMIT 1
0.693 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
942
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 56685
ORDER BY `position`
0.690 ms 1 Yes /classes/Product.php:3545
1134
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (57043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.689 ms 1 Yes Yes /classes/Product.php:4520
299
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25478) AND (b.`id_shop` = 1) LIMIT 1
0.678 ms 1 /src/Adapter/EntityMapper.php:71
946
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 60901
ORDER BY `position`
0.677 ms 1 Yes /classes/Product.php:3545
297
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25478
AND image_shop.`cover` = 1 LIMIT 1
0.668 ms 1 /classes/Product.php:3570
1160
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.667 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25476
ORDER BY f.position ASC
0.657 ms 5 Yes /classes/Product.php:6015
916
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 67889 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 67889 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.653 ms 0 /classes/Cart.php:1423
951
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 68236
ORDER BY `position`
0.647 ms 3 Yes /classes/Product.php:3545
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `uag_hook`
0.641 ms 1128 /classes/Hook.php:1292
937
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 54725
ORDER BY `position`
0.638 ms 1 Yes /classes/Product.php:3545
161
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25468
ORDER BY f.position ASC
0.635 ms 5 Yes /classes/Product.php:6015
61
SELECT SQL_NO_CACHE *
FROM `uag_category` a0
LEFT JOIN `uag_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 1241) AND (a0.`nright` > 1246) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.632 ms 97 Yes /classes/PrestaShopCollection.php:383
1130
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 56685 LIMIT 1
0.624 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
841
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25510
ORDER BY f.position ASC
0.622 ms 5 Yes /classes/Product.php:6015
197
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25472 AND `id_group` = 1 LIMIT 1
0.621 ms 0 /classes/GroupReduction.php:156
221
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.620 ms 1 /classes/Product.php:5655
185
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25471)
0.619 ms 1 /classes/Product.php:3860
228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25474 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25474 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.617 ms 0 /classes/Cart.php:1423
262
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45800) AND (b.`id_shop` = 1) LIMIT 1
0.613 ms 1 /src/Adapter/EntityMapper.php:71
238
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25475 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25475 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.608 ms 0 /classes/Cart.php:1423
851
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 54724
AND image_shop.`cover` = 1 LIMIT 1
0.606 ms 1 /classes/Product.php:3570
1117
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54726)
GROUP BY a0.`id_supplier`
0.604 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25476 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25476 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.588 ms 0 /classes/Cart.php:1423
20
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.582 ms 1 Yes Yes /classes/Supplier.php:139
949
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 67889
ORDER BY `position`
0.572 ms 3 Yes /classes/Product.php:3545
1137
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.568 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
183
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25471) AND (b.`id_shop` = 1) LIMIT 1
0.564 ms 1 /src/Adapter/EntityMapper.php:71
1039
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitelementor" LIMIT 1
0.559 ms 1 /classes/module/Module.php:2636
526
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.iso_lang="it") AND (ff.id_shop=1)
0.548 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:109
332
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 57073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.546 ms 1 /classes/stock/StockAvailable.php:753
258
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25477 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25477 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.543 ms 0 /classes/Cart.php:1423
840
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25510 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25510 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.541 ms 0 /classes/Cart.php:1423
25
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `uag_meta` m
LEFT JOIN `uag_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.539 ms 64 Yes /classes/Dispatcher.php:654
45
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8347) AND (b.`id_shop` = 1) LIMIT 1
0.537 ms 1 /src/Adapter/EntityMapper.php:71
41
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7928
AND `id_shop` = 1 LIMIT 1
0.535 ms 1 /classes/Category.php:2450
508
DESCRIBE uag_ybc_blog_post
0.534 ms 1 /modules/ybc_blog/ybc_blog_defines.php:3141
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25478)
0.532 ms 1 /classes/Product.php:3860
939
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 54726
ORDER BY `position`
0.532 ms 1 Yes /classes/Product.php:3545
1104
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.528 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1045
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25510) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.525 ms 1 Yes Yes /classes/Product.php:4520
1176
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (68236) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.520 ms 1 Yes Yes /classes/Product.php:4520
252
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25477) AND (b.`id_shop` = 1) LIMIT 1
0.519 ms 1 /src/Adapter/EntityMapper.php:71
938
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 54725
0.516 ms 1 /classes/Product.php:2902
1077
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 54724 LIMIT 1
0.516 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
218
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25473 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25473 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1423
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.509 ms 128 /classes/module/Module.php:345
1106
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (54726) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.509 ms 1 Yes Yes /classes/Product.php:4520
83
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 58334 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 58334 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.507 ms 0 /classes/Cart.php:1423
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.504 ms 128 /classes/module/Module.php:345
219
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25473
ORDER BY f.position ASC
0.501 ms 5 Yes /classes/Product.php:6015
1054
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:58" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:58" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.500 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1072
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.500 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
76
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.499 ms 2 Yes /classes/tax/TaxRulesTaxManager.php:109
1165
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.497 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
927
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 68236
ORDER BY f.position ASC
0.495 ms 4 Yes /classes/Product.php:6015
479
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45802) LIMIT 1
0.492 ms 1 /src/Adapter/EntityMapper.php:71
926
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 68236 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 68236 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.492 ms 0 /classes/Cart.php:1423
858
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 54724 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 54724 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1423
239
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25475
ORDER BY f.position ASC
0.489 ms 5 Yes /classes/Product.php:6015
191
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25472
AND image_shop.`cover` = 1 LIMIT 1
0.486 ms 1 /classes/Product.php:3570
242
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25476) AND (b.`id_shop` = 1) LIMIT 1
0.484 ms 1 /src/Adapter/EntityMapper.php:71
834
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25510) AND (b.`id_shop` = 1) LIMIT 1
0.480 ms 1 /src/Adapter/EntityMapper.php:71
21
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.477 ms 1 Yes Yes /classes/Supplier.php:139
160
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25468 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25468 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.477 ms 0 /classes/Cart.php:1423
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.476 ms 128 /classes/module/Module.php:345
411
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25472
0.476 ms 2 /classes/Tag.php:244
29
SELECT SQL_NO_CACHE * FROM `uag_currency` c ORDER BY `iso_code` ASC
0.475 ms 1 Yes /classes/Currency.php:709
1005
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 68236) LIMIT 1
0.472 ms 1 /src/Adapter/EntityMapper.php:71
179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25470 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25470 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.470 ms 0 /classes/Cart.php:1423
931
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45824) AND (b.`id_shop` = 1) LIMIT 1
0.470 ms 1 /src/Adapter/EntityMapper.php:71
1062
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:58" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:58" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.468 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
254
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25477)
0.466 ms 1 /classes/Product.php:3860
850
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45824
ORDER BY f.position ASC
0.464 ms 5 Yes /classes/Product.php:6015
1076
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.462 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
209
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45799
ORDER BY f.position ASC
0.459 ms 5 Yes /classes/Product.php:6015
1027
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.458 ms 1 /classes/module/Module.php:2636
94
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25448 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25448 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.456 ms 0 /classes/Cart.php:1423
935
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 54724
ORDER BY `position`
0.454 ms 1 Yes /classes/Product.php:3545
1144
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 57043 LIMIT 1
0.453 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
917
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 67889
ORDER BY f.position ASC
0.452 ms 5 Yes /classes/Product.php:6015
288
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45803
AND image_shop.`cover` = 1 LIMIT 1
0.451 ms 1 /classes/Product.php:3570
295
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45803 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45803 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.450 ms 0 /classes/Cart.php:1423
1026
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.448 ms 1 /classes/module/Module.php:2109
1067
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.448 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1162
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (67889) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.447 ms 1 Yes Yes /classes/Product.php:4520
955
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.443 ms 1 /src/Adapter/EntityMapper.php:71
1146
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.442 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1198
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 4) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.441 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
222
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25474) AND (b.`id_shop` = 1) LIMIT 1
0.440 ms 1 /src/Adapter/EntityMapper.php:71
868
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 54725 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 54725 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.438 ms 0 /classes/Cart.php:1423
1090
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.436 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1081
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.435 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
862
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54725) AND (b.`id_shop` = 1) LIMIT 1
0.432 ms 1 /src/Adapter/EntityMapper.php:71
932
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 45824
ORDER BY `position`
0.432 ms 1 Yes /classes/Product.php:3545
954
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.432 ms 1 /classes/Category.php:2242
287
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45802
ORDER BY f.position ASC
0.430 ms 6 Yes /classes/Product.php:6015
1048
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:58" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:58" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.429 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
17
SELECT SQL_NO_CACHE name, alias FROM `uag_hook_alias`
0.427 ms 88 /classes/Hook.php:339
200
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25472
ORDER BY f.position ASC
0.426 ms 5 Yes /classes/Product.php:6015
268
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45800 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45800 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.425 ms 0 /classes/Cart.php:1423
1142
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.424 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
959
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25510) LIMIT 1
0.424 ms 1 /src/Adapter/EntityMapper.php:71
103
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 57073 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 57073 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1423
217
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.422 ms 1 /classes/stock/StockAvailable.php:453
1092
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (54725) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.422 ms 1 Yes Yes /classes/Product.php:4520
3
SELECT SQL_NO_CACHE *
FROM `uag_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.421 ms 1 /src/Adapter/EntityMapper.php:71
277
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45801 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45801 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.420 ms 0 /classes/Cart.php:1423
49
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.417 ms 3 /classes/CartRule.php:423
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25478 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25478 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.416 ms 0 /classes/Cart.php:1423
832
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25510
AND image_shop.`cover` = 1 LIMIT 1
0.415 ms 1 /classes/Product.php:3570
1136
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 57043)
GROUP BY a0.`id_supplier`
0.414 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
403
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25471
0.410 ms 2 /classes/Tag.php:244
971
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45824) LIMIT 1
0.409 ms 1 /src/Adapter/EntityMapper.php:71
1046
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 25510 LIMIT 1
0.408 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25470
ORDER BY f.position ASC
0.407 ms 5 Yes /classes/Product.php:6015
269
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45800
ORDER BY f.position ASC
0.406 ms 5 Yes /classes/Product.php:6015
920
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 68236) AND (b.`id_shop` = 1) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
130
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 54720 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 54720 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.405 ms 0 /classes/Cart.php:1423
190
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25471
ORDER BY f.position ASC
0.402 ms 5 Yes /classes/Product.php:6015
1037
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.402 ms 1 /classes/module/Module.php:2636
169
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25469 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25469 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.401 ms 0 /classes/Cart.php:1423
212
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25473) AND (b.`id_shop` = 1) LIMIT 1
0.400 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.398 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
69
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 58334) AND (b.`id_shop` = 1) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
1184
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.397 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
27
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.395 ms 128 /classes/module/Module.php:345
237
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25475) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.395 ms 1 /classes/stock/StockAvailable.php:453
960
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25510 AND `id_shop` = 1
0.394 ms 1 /src/Adapter/EntityMapper.php:79
84
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 58334
ORDER BY f.position ASC
0.393 ms 4 Yes /classes/Product.php:6015
1074
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 45824 LIMIT 1
0.393 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1202
SELECT SQL_NO_CACHE `id_guest`
FROM `uag_connections`
WHERE `id_guest` = 843
AND `date_add` > '2024-05-08 13:54:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.392 ms 1 Yes /classes/Connection.php:168
95
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25448
ORDER BY f.position ASC
0.391 ms 5 Yes /classes/Product.php:6015
278
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45801
ORDER BY f.position ASC
0.390 ms 5 Yes /classes/Product.php:6015
505
SELECT SQL_NO_CACHE g.id_group as value, gl.name as label FROM `uag_group` g
LEFT JOIN `uag_group_lang` gl ON (g.id_group=gl.id_group AND gl.id_lang="1")
WHERE g.id_group !="1" AND g.id_group !="2"
0.390 ms 6 /modules/ybc_blog/ybc_blog_defines.php:3038
1156
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.389 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
337
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 56686 LIMIT 1
0.387 ms 1 /classes/Product.php:1106
51
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.385 ms 1 /classes/CartRule.php:423
296
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 45803
ORDER BY f.position ASC
0.383 ms 5 Yes /classes/Product.php:6015
972
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45824 AND `id_shop` = 1
0.382 ms 1 /src/Adapter/EntityMapper.php:79
860
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 54725
AND image_shop.`cover` = 1 LIMIT 1
0.381 ms 1 /classes/Product.php:3570
19
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.380 ms 128 /classes/module/Module.php:345
439
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25475) LIMIT 1
0.380 ms 1 /src/Adapter/EntityMapper.php:71
173
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25470) AND (b.`id_shop` = 1) LIMIT 1
0.379 ms 1 /src/Adapter/EntityMapper.php:71
967
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7848 AND `id_shop` = 1
0.378 ms 1 /src/Adapter/EntityMapper.php:79
88
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25448) AND (b.`id_shop` = 1) LIMIT 1
0.375 ms 1 /src/Adapter/EntityMapper.php:71
1095
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.375 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
259
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25477
ORDER BY f.position ASC
0.374 ms 5 Yes /classes/Product.php:6015
1123
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.373 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
467
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=45800
0.372 ms 1 /classes/Tag.php:244
471
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45801) LIMIT 1
0.372 ms 1 /src/Adapter/EntityMapper.php:71
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25478
ORDER BY f.position ASC
0.370 ms 5 Yes /classes/Product.php:6015
1112
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54726 LIMIT 1
0.370 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1115
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54726 AND `id_group` = 0 LIMIT 1
0.370 ms 0 /classes/GroupReduction.php:156
473
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 45801
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.368 ms 0 /classes/Product.php:1732
1100
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.367 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
455
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25477) LIMIT 1
0.367 ms 1 /src/Adapter/EntityMapper.php:71
953
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c WHERE c.id_category = 7928 LIMIT 1
0.367 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.366 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54720) LIMIT 1
0.364 ms 1 /src/Adapter/EntityMapper.php:71
366
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25467) LIMIT 1
0.364 ms 1 /src/Adapter/EntityMapper.php:71
878
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 54726 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 54726 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.364 ms 0 /classes/Cart.php:1423
415
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45799) LIMIT 1
0.363 ms 1 /src/Adapter/EntityMapper.php:71
154
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25468) AND (b.`id_shop` = 1) LIMIT 1
0.362 ms 1 /src/Adapter/EntityMapper.php:71
234
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25475)
0.362 ms 1 /classes/Product.php:3860
835
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25510 LIMIT 1
0.362 ms 1 /classes/SpecificPrice.php:435
993
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 57043) LIMIT 1
0.362 ms 1 /src/Adapter/EntityMapper.php:71
286
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 45802 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 45802 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.361 ms 0 /classes/Cart.php:1423
113
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 56686
ORDER BY f.position ASC
0.360 ms 2 Yes /classes/Product.php:6015
1168
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 67889 LIMIT 1
0.359 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25471
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
512
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.357 ms 0 /classes/module/Module.php:2636
150
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25467 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25467 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.356 ms 0 /classes/Cart.php:1423
407
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25472) LIMIT 1
0.356 ms 1 /src/Adapter/EntityMapper.php:71
1089
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54724)
GROUP BY a0.`id_supplier`
0.355 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
431
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25474) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
975
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54724) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM uag_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.351 ms 1 /classes/shop/ShopUrl.php:182
285
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45802) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.350 ms 1 /classes/stock/StockAvailable.php:453
112
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 56686 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 56686 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.349 ms 0 /classes/Cart.php:1423
1151
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.349 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
545
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7928) LIMIT 1
0.346 ms 1 /src/Adapter/EntityMapper.php:71
1014
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `uag_currency` c
LEFT JOIN uag_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.346 ms 1 /classes/Currency.php:1136
464
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45800 AND `id_shop` = 1
0.345 ms 1 /src/Adapter/EntityMapper.php:79
96
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 57073
AND image_shop.`cover` = 1 LIMIT 1
0.345 ms 1 /classes/Product.php:3570
380
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25468) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.344 ms 1 /classes/stock/StockAvailable.php:778
210
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25473
AND image_shop.`cover` = 1 LIMIT 1
0.344 ms 1 /classes/Product.php:3570
463
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 45800) LIMIT 1
0.344 ms 1 /src/Adapter/EntityMapper.php:71
144
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25467) AND (b.`id_shop` = 1) LIMIT 1
0.343 ms 1 /src/Adapter/EntityMapper.php:71
329
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 57073 LIMIT 1
0.343 ms 1 /classes/Product.php:1106
121
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 56811 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 56811 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.339 ms 0 /classes/Cart.php:1423
214
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25473)
0.337 ms 1 /classes/Product.php:3860
54
SELECT SQL_NO_CACHE * FROM `uag_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.336 ms 8 Yes /classes/ImageType.php:109
151
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25467
ORDER BY f.position ASC
0.336 ms 5 Yes /classes/Product.php:6015
503
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund` gf
WHERE (gf.shop_id=1) AND (gf.sent= "0") LIMIT 1
0.336 ms 1 /modules/ganalyticspro/models/orderRefund.php:105
950
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 67889
0.335 ms 1 /classes/Product.php:2902
244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25476)
0.334 ms 1 /classes/Product.php:3860
330
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=57073
0.333 ms 1 /classes/Tag.php:244
854
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 54724)
0.333 ms 1 /classes/Product.php:3860
1170
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.333 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
64
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.330 ms 0 /classes/module/Module.php:2636
887
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 56685 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 56685 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.329 ms 0 /classes/Cart.php:1423
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25474)
0.327 ms 1 /classes/Product.php:3860
175
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25470)
0.326 ms 1 /classes/Product.php:3860
72
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 58334)
0.325 ms 1 /classes/Product.php:3860
66
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 58334
AND image_shop.`cover` = 1 LIMIT 1
0.325 ms 1 /classes/Product.php:3570
997
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 60901) LIMIT 1
0.325 ms 1 /src/Adapter/EntityMapper.php:71
1084
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54724 LIMIT 1
0.325 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1070
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 45824 LIMIT 1
0.324 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1075
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 45824)
GROUP BY a0.`id_supplier`
0.324 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1153
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 60901
0.322 ms 4 /override/classes/Product.php:24
90
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25448)
0.321 ms 1 /classes/Product.php:3860
460
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.320 ms 1 /classes/stock/StockAvailable.php:778
1116
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54726 LIMIT 1
0.320 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
139
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 54719 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 54719 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.319 ms 0 /classes/Cart.php:1423
1200
SELECT SQL_NO_CACHE *
FROM `uag_cms` a
LEFT JOIN `uag_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `uag_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) AND (b.`id_shop` = 1) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
423
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25473) LIMIT 1
0.318 ms 1 /src/Adapter/EntityMapper.php:71
1179
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.318 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
104
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 57073
ORDER BY f.position ASC
0.317 ms 2 Yes /classes/Product.php:6015
264
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45800)
0.317 ms 1 /classes/Product.php:3860
897
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 57043 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 57043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.317 ms 0 /classes/Cart.php:1423
195
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25472)
0.315 ms 1 /classes/Product.php:3860
116
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 56811 LIMIT 1
0.315 ms 1 /classes/SpecificPrice.php:435
495
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25478) LIMIT 1
0.312 ms 1 /src/Adapter/EntityMapper.php:71
908
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 60901
ORDER BY f.position ASC
0.312 ms 4 Yes /classes/Product.php:6015
981
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54725) LIMIT 1
0.311 ms 1 /src/Adapter/EntityMapper.php:71
1071
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 45824)
GROUP BY a0.`id_supplier`
0.310 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
170
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25469
ORDER BY f.position ASC
0.310 ms 5 Yes /classes/Product.php:6015
131
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 54720
ORDER BY f.position ASC
0.309 ms 2 Yes /classes/Product.php:6015
1119
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 56685 LIMIT 1
0.309 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
869
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 54725
ORDER BY f.position ASC
0.308 ms 4 Yes /classes/Product.php:6015
1145
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 57043)
GROUP BY a0.`id_supplier`
0.308 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1131
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 56685)
GROUP BY a0.`id_supplier`
0.307 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1188
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.307 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1061
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 25510)
GROUP BY a0.`id_supplier`
0.306 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1043
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1
0.305 ms 1 /classes/module/Module.php:2109
240
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25476
AND image_shop.`cover` = 1 LIMIT 1
0.304 ms 1 /classes/Product.php:3570
836
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25510)
0.304 ms 1 /classes/Product.php:3860
1017
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.304 ms 1 /classes/module/Module.php:2636
1091
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 54725 LIMIT 1
0.302 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
39
SELECT SQL_NO_CACHE *
FROM `uag_group_lang`
WHERE `id_group` = 1
0.300 ms 1 /src/Adapter/EntityMapper.php:79
85
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.300 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:109
1105
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 54726 LIMIT 1
0.299 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
458
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25477 LIMIT 1
0.297 ms 1 /classes/Product.php:1106
918
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 68236
AND image_shop.`cover` = 1 LIMIT 1
0.297 ms 3 /classes/Product.php:3570
1030
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.297 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
1158
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 60901 LIMIT 1
0.297 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
344
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 56811
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.296 ms 0 /classes/Product.php:1732
842
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45824
AND image_shop.`cover` = 1 LIMIT 1
0.296 ms 1 /classes/Product.php:3570
907
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 60901 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 60901 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.295 ms 0 /classes/Cart.php:1423
1111
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 54726
0.295 ms 4 /override/classes/Product.php:24
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM uag_shop s
LEFT JOIN uag_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.294 ms 1 /classes/shop/Shop.php:218
1110
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 54726
0.294 ms 3 /classes/Product.php:3423
291
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45803)
0.293 ms 1 /classes/Product.php:3860
334
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 56686) LIMIT 1
0.293 ms 1 /src/Adapter/EntityMapper.php:71
1057
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.293 ms 0 /classes/tax/TaxRulesTaxManager.php:109
331
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 57073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:778
326
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 57073) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
201
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45799
AND image_shop.`cover` = 1 LIMIT 1
0.290 ms 1 /classes/Product.php:3570
432
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25474 AND `id_shop` = 1
0.290 ms 1 /src/Adapter/EntityMapper.php:79
358
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54719) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
1066
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 45824)
GROUP BY a0.`id_supplier`
0.289 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
307
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 58334) LIMIT 1
0.288 ms 1 /src/Adapter/EntityMapper.php:71
1065
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 45824 LIMIT 1
0.288 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1069
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 45824
0.288 ms 5 /override/classes/Product.php:24
1155
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 60901)
GROUP BY a0.`id_supplier`
0.288 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
114
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 56811
AND image_shop.`cover` = 1 LIMIT 1
0.287 ms 1 /classes/Product.php:3570
383
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25469) LIMIT 1
0.287 ms 1 /src/Adapter/EntityMapper.php:71
448
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25476 AND `id_shop` = 1
0.287 ms 1 /src/Adapter/EntityMapper.php:79
1085
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54724)
GROUP BY a0.`id_supplier`
0.286 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1083
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 54724
0.285 ms 4 /override/classes/Product.php:24
253
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25477 LIMIT 1
0.284 ms 1 /classes/SpecificPrice.php:435
1042
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitreviews" LIMIT 1
0.283 ms 1 /classes/module/Module.php:2636
1103
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54725)
GROUP BY a0.`id_supplier`
0.283 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
517
CREATE TABLE IF NOT EXISTS `uag_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.282 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1050
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 25510
0.282 ms 5 /override/classes/Product.php:24
912
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 67889)
0.282 ms 1 /classes/Product.php:3860
879
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 54726
ORDER BY f.position ASC
0.281 ms 4 Yes /classes/Product.php:6015
1055
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration` a
WHERE (a.`id_multipleprices_configuration` = 1) LIMIT 1
0.281 ms 1 /src/Adapter/EntityMapper.php:71
985
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54726) LIMIT 1
0.280 ms 1 /src/Adapter/EntityMapper.php:71
1053
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 25510)
GROUP BY a0.`id_supplier`
0.280 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1023
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcompare" LIMIT 1
0.279 ms 1 /classes/module/Module.php:2636
968
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 3) LIMIT 1
0.278 ms 1 /src/Adapter/EntityMapper.php:71
974
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45824 LIMIT 1
0.278 ms 1 /classes/Product.php:1106
220
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25474
AND image_shop.`cover` = 1 LIMIT 1
0.277 ms 1 /classes/Product.php:3570
246
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25476 AND `id_group` = 1 LIMIT 1
0.277 ms 0 /classes/GroupReduction.php:156
1001
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 67889) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
399
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25471) LIMIT 1
0.276 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45802)
0.276 ms 1 /classes/Product.php:3860
318
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25448) LIMIT 1
0.276 ms 1 /src/Adapter/EntityMapper.php:71
1139
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 57043
0.274 ms 4 /override/classes/Product.php:24
1125
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 56685
0.273 ms 4 /override/classes/Product.php:24
140
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 54719
ORDER BY f.position ASC
0.272 ms 2 Yes /classes/Product.php:6015
171
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25470
AND image_shop.`cover` = 1 LIMIT 1
0.272 ms 1 /classes/Product.php:3570
227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.272 ms 1 /classes/stock/StockAvailable.php:453
1113
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54726)
GROUP BY a0.`id_supplier`
0.272 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1013
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.271 ms 1 /classes/module/Module.php:2109
1195
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 1) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.271 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
855
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 54724 AND id_shop=1 LIMIT 1
0.270 ms 1 /classes/Product.php:6870
1161
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 67889 LIMIT 1
0.269 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1047
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 25510)
GROUP BY a0.`id_supplier`
0.268 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
146
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25467)
0.268 ms 1 /classes/Product.php:3860
449
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25476
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.268 ms 0 /classes/Product.php:1732
279
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45802
AND image_shop.`cover` = 1 LIMIT 1
0.267 ms 1 /classes/Product.php:3570
1004
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 67889 LIMIT 1
0.267 ms 1 /classes/Product.php:1106
1169
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 67889)
GROUP BY a0.`id_supplier`
0.267 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1088
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54724 LIMIT 1
0.266 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
437
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:753
1166
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 67889
0.265 ms 3 /classes/Product.php:3423
442
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25475 LIMIT 1
0.265 ms 1 /classes/Product.php:1106
1174
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:24:59" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:24:59" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28520, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.264 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
375
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25468) LIMIT 1
0.264 ms 1 /src/Adapter/EntityMapper.php:71
198
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.263 ms 1 /classes/stock/StockAvailable.php:453
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25474 AND id_shop=1 LIMIT 1
0.263 ms 1 /classes/Product.php:6870
1159
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 60901)
GROUP BY a0.`id_supplier`
0.263 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
122
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 56811
ORDER BY f.position ASC
0.262 ms 2 Yes /classes/Product.php:6015
391
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25470) LIMIT 1
0.262 ms 1 /src/Adapter/EntityMapper.php:71
1024
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.262 ms 1 /classes/module/Module.php:2109
532
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.261 ms 1 /src/Adapter/EntityMapper.php:71
35
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.259 ms 1 /src/Adapter/EntityMapper.php:71
322
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25448
0.258 ms 2 /classes/Tag.php:244
962
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8347) LIMIT 1
0.258 ms 1 /src/Adapter/EntityMapper.php:71
58
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.257 ms 1 /src/Adapter/EntityMapper.php:71
429
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:753
956
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7928 LIMIT 1
0.257 ms 1 /classes/Category.php:1585
1147
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 60901 LIMIT 1
0.257 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
970
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25510 LIMIT 1
0.256 ms 1 /classes/Product.php:1106
899
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 60901
AND image_shop.`cover` = 1 LIMIT 1
0.256 ms 1 /classes/Product.php:3570
165
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25469)
0.255 ms 1 /classes/Product.php:3860
376
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25468 AND `id_shop` = 1
0.254 ms 1 /src/Adapter/EntityMapper.php:79
870
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 54726
AND image_shop.`cover` = 1 LIMIT 1
0.254 ms 1 /classes/Product.php:3570
989
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 56685) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
1019
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.254 ms 1 /classes/module/Module.php:2636
1082
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 54724
0.254 ms 3 /classes/Product.php:3423
898
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 57043
ORDER BY f.position ASC
0.253 ms 4 Yes /classes/Product.php:6015
28
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7928) AND (b.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
888
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 56685
ORDER BY f.position ASC
0.252 ms 4 Yes /classes/Product.php:6015
361
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 54719 LIMIT 1
0.251 ms 1 /classes/Product.php:1106
845
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45824)
0.251 ms 1 /classes/Product.php:3860
891
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 57043) AND (b.`id_shop` = 1) LIMIT 1
0.251 ms 1 /src/Adapter/EntityMapper.php:71
872
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 54726) AND (b.`id_shop` = 1) LIMIT 1
0.250 ms 1 /src/Adapter/EntityMapper.php:71
1194
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.250 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
34
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.248 ms 1 /classes/Language.php:883
338
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=56686
0.248 ms 1 /classes/Tag.php:244
964
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
909
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 67889
AND image_shop.`cover` = 1 LIMIT 1
0.247 ms 3 /classes/Product.php:3570
1167
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 67889
0.247 ms 5 /override/classes/Product.php:24
546
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7928 AND `id_shop` = 1
0.246 ms 1 /src/Adapter/EntityMapper.php:79
1164
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 67889)
GROUP BY a0.`id_supplier`
0.246 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
451
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25476
0.246 ms 2 /classes/Tag.php:244
1025
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitsearch" LIMIT 1
0.246 ms 1 /classes/module/Module.php:2636
345
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 56811 LIMIT 1
0.245 ms 1 /classes/Product.php:1106
1041
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c LEFT JOIN uag_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 7928 AND s.id_shop = 1 LIMIT 1
0.245 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
966
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7848) LIMIT 1
0.245 ms 1 /src/Adapter/EntityMapper.php:71
474
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45801 LIMIT 1
0.243 ms 1 /classes/Product.php:1106
475
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=45801
0.243 ms 1 /classes/Tag.php:244
1199
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 5) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.242 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25477
AND image_shop.`cover` = 1 LIMIT 1
0.241 ms 1 /classes/Product.php:3570
483
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=45802
0.241 ms 1 /classes/Tag.php:244
963
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8347 AND `id_shop` = 1
0.241 ms 1 /src/Adapter/EntityMapper.php:79
77
SELECT SQL_NO_CACHE *
FROM `uag_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.240 ms 1 /src/Adapter/EntityMapper.php:71
457
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25477
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.240 ms 0 /classes/Product.php:1732
1031
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.240 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
901
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 60901) AND (b.`id_shop` = 1) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
992
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 56685 LIMIT 1
0.239 ms 1 /classes/Product.php:1106
241
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.239 ms 1 /classes/Product.php:5655
1141
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 57043)
GROUP BY a0.`id_supplier`
0.239 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
81
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.238 ms 0 /classes/tax/TaxRulesTaxManager.php:109
6
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.237 ms 1 /src/Adapter/EntityMapper.php:71
257
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.237 ms 1 /classes/stock/StockAvailable.php:453
446
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25475) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.237 ms 1 /classes/stock/StockAvailable.php:806
1044
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 25510 LIMIT 1
0.237 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1068
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 45824
0.237 ms 3 /classes/Product.php:3423
22
SELECT SQL_NO_CACHE DISTINCT g.`id_group`, g.`reduction`, g.`price_display_method`, g.`show_prices`, gl.`name`
FROM `uag_group` g
LEFT JOIN `uag_group_lang` AS gl ON (g.`id_group` = gl.`id_group` AND gl.`id_lang` = 1)
ORDER BY g.`id_group` ASC
0.236 ms 6 Yes /classes/Group.php:111
472
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45801 AND `id_shop` = 1
0.235 ms 1 /src/Adapter/EntityMapper.php:79
260
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45800
AND image_shop.`cover` = 1 LIMIT 1
0.234 ms 1 /classes/Product.php:3570
223
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25474 LIMIT 1
0.234 ms 1 /classes/SpecificPrice.php:435
919
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.234 ms 1 /classes/Product.php:5655
52
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.233 ms 0 /classes/module/Module.php:2636
105
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 56686
AND image_shop.`cover` = 1 LIMIT 1
0.233 ms 1 /classes/Product.php:3570
156
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25468)
0.233 ms 1 /classes/Product.php:3860
456
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25477 AND `id_shop` = 1
0.233 ms 1 /src/Adapter/EntityMapper.php:79
126
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 54720)
0.232 ms 1 /classes/Product.php:3860
194
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25472 LIMIT 1
0.232 ms 1 /classes/SpecificPrice.php:435
424
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25473 AND `id_shop` = 1
0.232 ms 1 /src/Adapter/EntityMapper.php:79
940
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 54726
0.232 ms 1 /classes/Product.php:2902
1138
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 57043
0.232 ms 3 /classes/Product.php:3423
86
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25448
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
243
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25476 LIMIT 1
0.231 ms 1 /classes/SpecificPrice.php:435
969
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 3 AND `id_shop` = 1
0.231 ms 1 /src/Adapter/EntityMapper.php:79
409
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25472
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.230 ms 0 /classes/Product.php:1732
459
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25477
0.229 ms 2 /classes/Tag.php:244
965
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.229 ms 1 /src/Adapter/EntityMapper.php:79
33
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.228 ms 1 /src/Adapter/EntityMapper.php:71
162
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25469
AND image_shop.`cover` = 1 LIMIT 1
0.228 ms 1 /classes/Product.php:3570
1108
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54726)
GROUP BY a0.`id_supplier`
0.227 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
168
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:453
352
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 54720
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.227 ms 0 /classes/Product.php:1732
922
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 68236)
0.227 ms 1 /classes/Product.php:3860
59
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 10
0.226 ms 1 /src/Adapter/EntityMapper.php:79
998
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 60901 AND `id_shop` = 1
0.226 ms 1 /src/Adapter/EntityMapper.php:79
1102
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54725 LIMIT 1
0.226 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `uag_lang` l
LEFT JOIN `uag_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.225 ms 1 /classes/Language.php:1080
465
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 45800
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.225 ms 0 /classes/Product.php:1732
1006
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 68236 AND `id_shop` = 1
0.225 ms 1 /src/Adapter/EntityMapper.php:79
1197
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 3) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.225 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
874
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 54726)
0.225 ms 1 /classes/Product.php:3860
913
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 67889 AND id_shop=1 LIMIT 1
0.225 ms 1 /classes/Product.php:6870
1154
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 60901 LIMIT 1
0.224 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1163
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 67889 LIMIT 1
0.224 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
117
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 56811)
0.221 ms 1 /classes/Product.php:3860
270
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 45801
AND image_shop.`cover` = 1 LIMIT 1
0.221 ms 1 /classes/Product.php:3570
466
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45800 LIMIT 1
0.221 ms 1 /classes/Product.php:1106
343
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 56811 AND `id_shop` = 1
0.221 ms 1 /src/Adapter/EntityMapper.php:79
1135
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 57043 LIMIT 1
0.221 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
38
SELECT SQL_NO_CACHE *
FROM `uag_group` a
LEFT JOIN `uag_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.220 ms 1 /src/Adapter/EntityMapper.php:71
335
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 56686 AND `id_shop` = 1
0.220 ms 1 /src/Adapter/EntityMapper.php:79
915
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 67889) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.220 ms 1 /classes/stock/StockAvailable.php:453
172
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.220 ms 1 /classes/Product.php:5655
445
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25475) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.219 ms 1 /classes/stock/StockAvailable.php:753
1140
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 57043 LIMIT 1
0.219 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
509
UPDATE `uag_ybc_blog_post` SET enabled=1,datetime_added="2024-05-08 14:24:57",datetime_modified="2024-05-08 14:24:57" WHERE datetime_active!="0000-00-00" AND datetime_active is not NULL AND enabled=2 AND datetime_active<=NOW()
0.219 ms 1 /modules/ybc_blog/classes/ybc_blog_post_class.php:622
990
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 56685 AND `id_shop` = 1
0.219 ms 1 /src/Adapter/EntityMapper.php:79
1049
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 25510
0.219 ms 3 /classes/Product.php:3423
925
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 68236) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:453
204
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45799)
0.217 ms 1 /classes/Product.php:3860
427
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25473
0.217 ms 2 /classes/Tag.php:244
251
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.216 ms 1 /classes/Product.php:5655
943
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 56685
0.216 ms 1 /classes/Product.php:2902
273
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 45801)
0.215 ms 1 /classes/Product.php:3860
504
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund_partial` grf
WHERE (grf.shop_id=1) AND (grf.sent= "0") LIMIT 1
0.215 ms 1 /modules/ganalyticspro/models/orderPartialRefund.php:105
996
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 57043 LIMIT 1
0.215 ms 1 /classes/Product.php:1106
351
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 54720 AND `id_shop` = 1
0.214 ms 1 /src/Adapter/EntityMapper.php:79
1073
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45824 AND `id_group` = 0 LIMIT 1
0.214 ms 0 /classes/GroupReduction.php:156
1122
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 56685)
GROUP BY a0.`id_supplier`
0.214 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
324
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.214 ms 1 /classes/stock/StockAvailable.php:753
435
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25474
0.214 ms 2 /classes/Tag.php:244
255
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25477 AND id_shop=1 LIMIT 1
0.213 ms 1 /classes/Product.php:6870
410
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25472 LIMIT 1
0.213 ms 1 /classes/Product.php:1106
416
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45799 AND `id_shop` = 1
0.213 ms 1 /src/Adapter/EntityMapper.php:79
549
SELECT SQL_NO_CACHE data FROM uag_layered_filter_block WHERE hash="47360a2b19910f3f6c0e63166236abef" LIMIT 1
0.212 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
207
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.211 ms 1 /classes/stock/StockAvailable.php:453
1204
SELECT SQL_NO_CACHE `id_page`
FROM `uag_page`
WHERE `id_page_type` = 7 AND `id_object` = 7928 LIMIT 1
0.211 ms 1 /classes/Page.php:83
346
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=56811
0.210 ms 1 /classes/Tag.php:244
961
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 25510) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.210 ms 1 /classes/Product.php:7720
141
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25467
AND image_shop.`cover` = 1 LIMIT 1
0.210 ms 1 /classes/Product.php:3570
1012
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.209 ms 1 /classes/module/Module.php:2636
973
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 45824) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.209 ms 1 /classes/Product.php:7720
1056
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration_lang`
WHERE `id_multipleprices_configuration` = 1
0.209 ms 1 /src/Adapter/EntityMapper.php:79
488
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 45803 AND `id_shop` = 1
0.208 ms 1 /src/Adapter/EntityMapper.php:79
979
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8346 AND `id_shop` = 1
0.208 ms 1 /src/Adapter/EntityMapper.php:79
1038
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.208 ms 1 /classes/module/Module.php:2109
529
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.208 ms 1 /classes/Currency.php:893
336
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 56686
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.207 ms 0 /classes/Product.php:1732
393
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25470
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.207 ms 0 /classes/Product.php:1732
499
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25478
0.207 ms 2 /classes/Tag.php:244
30
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.206 ms 1 /classes/Language.php:883
60
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM uag_required_field
0.206 ms 1 /classes/ObjectModel.php:1592
263
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45800 LIMIT 1
0.206 ms 1 /classes/SpecificPrice.php:435
341
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 56686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:806
412
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:778
235
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25475 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6870
1099
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54725)
GROUP BY a0.`id_supplier`
0.204 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
484
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 45802) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.203 ms 1 /classes/stock/StockAvailable.php:778
833
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.203 ms 1 /classes/Product.php:5655
400
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25471 AND `id_shop` = 1
0.203 ms 1 /src/Adapter/EntityMapper.php:79
433
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25474
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.202 ms 0 /classes/Product.php:1732
7
SELECT SQL_NO_CACHE *
FROM `uag_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.202 ms 1 /src/Adapter/EntityMapper.php:71
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `uag_hook_alias`
0.202 ms 88 /classes/Hook.php:287
108
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 56686)
0.202 ms 1 /classes/Product.php:3860
132
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 54719
AND image_shop.`cover` = 1 LIMIT 1
0.202 ms 1 /classes/Product.php:3570
408
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25472 AND `id_shop` = 1
0.202 ms 1 /src/Adapter/EntityMapper.php:79
468
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 45800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:778
921
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 68236 LIMIT 1
0.202 ms 1 /classes/SpecificPrice.php:435
980
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 54724 LIMIT 1
0.202 ms 1 /classes/Product.php:1106
1087
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54724 AND `id_group` = 0 LIMIT 1
0.202 ms 0 /classes/GroupReduction.php:156
1098
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54725 LIMIT 1
0.202 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1173
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 67889)
GROUP BY a0.`id_supplier`
0.202 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
417
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 45799
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.201 ms 0 /classes/Product.php:1732
485
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 45802) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:753
1029
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171098
0.201 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
312
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 58334 LIMIT 1
0.200 ms 1 /classes/Product.php:1106
349
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 56811) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.200 ms 1 /classes/stock/StockAvailable.php:806
527
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'IT' LIMIT 1
0.200 ms 1 /classes/Country.php:194
135
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 54719)
0.199 ms 1 /classes/Product.php:3860
1022
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.199 ms 1 /classes/module/Module.php:2109
1143
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 57043 AND `id_group` = 0 LIMIT 1
0.199 ms 0 /classes/GroupReduction.php:156
1175
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 68236 LIMIT 1
0.199 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1181
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 68236
0.199 ms 4 /override/classes/Product.php:24
99
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 57073)
0.199 ms 1 /classes/Product.php:3860
397
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25470) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:753
452
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:778
236
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25475 AND `id_group` = 1 LIMIT 1
0.198 ms 0 /classes/GroupReduction.php:156
245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25476 AND id_shop=1 LIMIT 1
0.198 ms 1 /classes/Product.php:6870
188
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:453
864
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 54725)
0.197 ms 1 /classes/Product.php:3860
184
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25471 LIMIT 1
0.196 ms 1 /classes/SpecificPrice.php:435
903
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 60901)
0.196 ms 1 /classes/Product.php:3860
1008
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 68236 LIMIT 1
0.196 ms 1 /classes/Product.php:1106
216
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25473 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
893
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 57043)
0.194 ms 1 /classes/Product.php:3860
82
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 58334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
1009
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7928 LIMIT 1
0.193 ms 1 /classes/Category.php:1585
443
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25475
0.193 ms 2 /classes/Tag.php:244
982
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 54725 AND `id_shop` = 1
0.192 ms 1 /src/Adapter/EntityMapper.php:79
401
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25471
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.192 ms 0 /classes/Product.php:1732
489
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 45803
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.192 ms 0 /classes/Product.php:1732
1052
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 25510 LIMIT 1
0.192 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
395
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25470
0.191 ms 2 /classes/Tag.php:244
354
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=54720
0.191 ms 1 /classes/Tag.php:244
541
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7928
AND `id_shop` = 1 LIMIT 1
0.191 ms 1 /classes/Category.php:2450
8
SELECT SQL_NO_CACHE *
FROM `uag_lang` a
LEFT JOIN `uag_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.190 ms 1 /src/Adapter/EntityMapper.php:71
493
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 45803) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.190 ms 1 /classes/stock/StockAvailable.php:753
528
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 10 LIMIT 1
0.190 ms 1 /classes/Country.php:252
70
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 0 LIMIT 1
0.189 ms 1 /classes/SpecificPrice.php:426
476
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 45801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:778
192
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.189 ms 1 /classes/Product.php:5655
877
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 54726) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:453
994
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 57043 AND `id_shop` = 1
0.188 ms 1 /src/Adapter/EntityMapper.php:79
425
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25473
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.188 ms 0 /classes/Product.php:1732
491
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=45803
0.188 ms 1 /classes/Tag.php:244
496
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25478 AND `id_shop` = 1
0.188 ms 1 /src/Adapter/EntityMapper.php:79
1016
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.188 ms 1 /classes/module/Module.php:2109
78
SELECT SQL_NO_CACHE *
FROM `uag_tax_lang`
WHERE `id_tax` = 1
0.187 ms 1 /src/Adapter/EntityMapper.php:79
102
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 57073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.187 ms 1 /classes/stock/StockAvailable.php:453
298
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.187 ms 1 /classes/Product.php:5655
68
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.187 ms 1 /classes/Product.php:5655
311
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 58334
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.187 ms 0 /classes/Product.php:1732
1035
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.187 ms 1 /classes/module/Module.php:2636
861
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.186 ms 1 /classes/Product.php:5655
36
SELECT SQL_NO_CACHE *
FROM `uag_currency_lang`
WHERE `id_currency` = 1
0.186 ms 1 /src/Adapter/EntityMapper.php:79
313
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=58334
0.186 ms 1 /classes/Tag.php:244
883
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 56685)
0.186 ms 1 /classes/Product.php:3860
178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25470) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:453
319
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25448 AND `id_shop` = 1
0.185 ms 1 /src/Adapter/EntityMapper.php:79
384
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25469 AND `id_shop` = 1
0.185 ms 1 /src/Adapter/EntityMapper.php:79
426
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25473 LIMIT 1
0.185 ms 1 /classes/Product.php:1106
986
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 54726 AND `id_shop` = 1
0.185 ms 1 /src/Adapter/EntityMapper.php:79
196
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25472 AND id_shop=1 LIMIT 1
0.184 ms 1 /classes/Product.php:6870
317
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8346 LIMIT 1
0.184 ms 0 /classes/Category.php:1378
320
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25448
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.184 ms 0 /classes/Product.php:1732
367
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25467 AND `id_shop` = 1
0.184 ms 1 /src/Adapter/EntityMapper.php:79
444
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25475) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:778
501
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25478) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:753
930
SELECT SQL_NO_CACHE state FROM uag_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.184 ms 1 /classes/FeatureFlag.php:105
1178
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68236)
GROUP BY a0.`id_supplier`
0.184 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
145
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25467 LIMIT 1
0.184 ms 1 /classes/SpecificPrice.php:435
434
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25474 LIMIT 1
0.184 ms 1 /classes/Product.php:1106
57
SELECT SQL_NO_CACHE *
FROM `uag_state` a
WHERE (a.`id_state` = 234) LIMIT 1
0.183 ms 1 /src/Adapter/EntityMapper.php:71
497
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25478
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.183 ms 0 /classes/Product.php:1732
1058
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25510 AND `id_group` = 0 LIMIT 1
0.183 ms 0 /classes/GroupReduction.php:156
1149
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 60901 LIMIT 1
0.183 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
511
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenterpro" LIMIT 1
0.182 ms 1 /classes/module/Module.php:2636
988
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 54726 LIMIT 1
0.182 ms 1 /classes/Product.php:1106
430
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.182 ms 1 /classes/stock/StockAvailable.php:806
202
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.181 ms 1 /classes/Product.php:5655
929
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 25510
0.181 ms 1 /classes/Product.php:2902
404
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.180 ms 1 /classes/stock/StockAvailable.php:778
991
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 56685) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.180 ms 1 /classes/Product.php:7720
149
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:453
453
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:753
454
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:806
1097
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 54725
0.179 ms 4 /override/classes/Product.php:24
1183
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68236)
GROUP BY a0.`id_supplier`
0.179 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
353
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 54720 LIMIT 1
0.179 ms 1 /classes/Product.php:1106
461
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:753
470
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 45800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:806
31
SELECT SQL_NO_CACHE value FROM `uag_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.178 ms 1 /classes/shop/Shop.php:1183
933
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 45824
0.178 ms 1 /classes/Product.php:2902
1040
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.178 ms 1 /classes/module/Module.php:2109
325
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:806
1196
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 2) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.177 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
413
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:753
486
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 45802) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:806
882
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 56685 LIMIT 1
0.177 ms 1 /classes/SpecificPrice.php:435
1007
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 68236) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.177 ms 1 /classes/Product.php:7720
1150
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 60901)
GROUP BY a0.`id_supplier`
0.177 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1129
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 56685 AND `id_group` = 0 LIMIT 1
0.176 ms 0 /classes/GroupReduction.php:156
26
SELECT SQL_NO_CACHE * FROM `uag_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.176 ms 1 /classes/module/Module.php:2018
362
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=54719
0.176 ms 1 /classes/Tag.php:244
377
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25468
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.176 ms 0 /classes/Product.php:1732
392
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25470 AND `id_shop` = 1
0.176 ms 1 /src/Adapter/EntityMapper.php:79
462
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25477) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:806
1033
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.176 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
93
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.175 ms 1 /classes/stock/StockAvailable.php:453
539
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "payplug" LIMIT 1
0.175 ms 1 /classes/module/Module.php:2636
63
SELECT SQL_NO_CACHE * FROM uag_revslider_sliders
0.174 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
152
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25468
AND image_shop.`cover` = 1 LIMIT 1
0.174 ms 1 /classes/Product.php:3570
187
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25471 AND `id_group` = 1 LIMIT 1
0.174 ms 0 /classes/GroupReduction.php:156
276
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:453
308
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 58334 AND `id_shop` = 1
0.174 ms 1 /src/Adapter/EntityMapper.php:79
379
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25468
0.174 ms 2 /classes/Tag.php:244
394
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25470 LIMIT 1
0.174 ms 1 /classes/Product.php:1106
1059
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 0 LIMIT 1
0.174 ms 0 /classes/Group.php:154
1015
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.174 ms 1 /classes/module/Module.php:2636
507
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 120 AND `id_shop` = 1 LIMIT 1
0.173 ms 1 /classes/module/Module.php:2109
978
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8346) LIMIT 1
0.173 ms 1 /src/Adapter/EntityMapper.php:71
984
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 54725 LIMIT 1
0.173 ms 1 /classes/Product.php:1106
1124
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 56685
0.173 ms 3 /classes/Product.php:3423
55
SELECT SQL_NO_CACHE format
FROM `uag_address_format`
WHERE `id_country` = 10 LIMIT 1
0.173 ms 1 /classes/AddressFormat.php:656
524
SELECT SQL_NO_CACHE id_feed
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.171 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:75
9
SELECT SQL_NO_CACHE id_shop
FROM `uag_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.171 ms 1 /classes/ObjectModel.php:1729
115
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.171 ms 1 /classes/Product.php:5655
848
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45824) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.171 ms 1 /classes/stock/StockAvailable.php:453
164
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25469 LIMIT 1
0.170 ms 1 /classes/SpecificPrice.php:435
441
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25475
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.170 ms 0 /classes/Product.php:1732
1093
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 54725 LIMIT 1
0.170 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
538
SELECT SQL_NO_CACHE `name`
FROM `uag_hook`
WHERE `id_hook` = 1003 LIMIT 1
0.168 ms 1 /classes/Hook.php:244
1034
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.167 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
1126
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 56685 LIMIT 1
0.166 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1182
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68236 LIMIT 1
0.166 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
67
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8346 LIMIT 1
0.166 ms 1 /classes/Category.php:1378
80
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 1 LIMIT 1
0.166 ms 1 /classes/Group.php:154
213
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25473 LIMIT 1
0.165 ms 1 /classes/SpecificPrice.php:435
1171
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 67889 AND `id_group` = 0 LIMIT 1
0.165 ms 0 /classes/GroupReduction.php:156
370
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25467
0.164 ms 2 /classes/Tag.php:244
983
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 54725) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.164 ms 1 /classes/Product.php:7720
1051
SELECT SQL_NO_CACHE `id_zone`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.164 ms 1 /classes/Country.php:224
1203
SELECT SQL_NO_CACHE id_page_type
FROM uag_page_type
WHERE name = 'category' LIMIT 1
0.163 ms 1 /classes/Page.php:104
372
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:753
1002
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 67889 AND `id_shop` = 1
0.163 ms 1 /src/Adapter/EntityMapper.php:79
839
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25510) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.162 ms 1 /classes/stock/StockAvailable.php:453
1028
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 8 AND `id_shop` = 1 LIMIT 1
0.162 ms 1 /classes/module/Module.php:2109
1094
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 54725)
GROUP BY a0.`id_supplier`
0.161 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
97
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.161 ms 1 /classes/Product.php:5655
1000
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 60901 LIMIT 1
0.161 ms 1 /classes/Product.php:1106
281
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45802 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
321
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25448 LIMIT 1
0.160 ms 1 /classes/Product.php:1106
369
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25467 LIMIT 1
0.160 ms 1 /classes/Product.php:1106
477
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 45801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:753
478
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 45801) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:806
844
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45824 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
880
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 56685
AND image_shop.`cover` = 1 LIMIT 1
0.160 ms 1 /classes/Product.php:3570
952
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 68236
0.160 ms 1 /classes/Product.php:2902
42
SELECT SQL_NO_CACHE ctg.`id_group`
FROM uag_category_group ctg
WHERE ctg.`id_category` = 7928 AND ctg.`id_group` = 1 LIMIT 1
0.159 ms 1 /classes/Category.php:1754
176
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25470 AND id_shop=1 LIMIT 1
0.159 ms 1 /classes/Product.php:6870
186
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25471 AND id_shop=1 LIMIT 1
0.159 ms 1 /classes/Product.php:6870
1157
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 60901 AND `id_group` = 0 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
914
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 67889 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
163
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.158 ms 1 /classes/Product.php:5655
418
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45799 LIMIT 1
0.158 ms 1 /classes/Product.php:1106
1192
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.158 ms 1 /classes/module/Module.php:2636
111
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 56686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.158 ms 1 /classes/stock/StockAvailable.php:453
385
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25469
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.157 ms 0 /classes/Product.php:1732
440
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 25475 AND `id_shop` = 1
0.157 ms 1 /src/Adapter/EntityMapper.php:79
519
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.157 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
910
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.157 ms 1 /classes/Product.php:5655
290
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45803 LIMIT 1
0.156 ms 1 /classes/SpecificPrice.php:435
339
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 56686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.156 ms 1 /classes/stock/StockAvailable.php:778
419
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=45799
0.156 ms 1 /classes/Tag.php:244
1101
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54725 AND `id_group` = 0 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
1036
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1
0.155 ms 1 /classes/module/Module.php:2109
159
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25468) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.155 ms 1 /classes/stock/StockAvailable.php:453
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25478 AND id_shop=1 LIMIT 1
0.155 ms 1 /classes/Product.php:6870
387
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=25469
0.155 ms 2 /classes/Tag.php:244
498
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25478 LIMIT 1
0.155 ms 1 /classes/Product.php:1106
101
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 57073 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
402
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25471 LIMIT 1
0.154 ms 1 /classes/Product.php:1106
911
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 67889 LIMIT 1
0.154 ms 1 /classes/SpecificPrice.php:435
1189
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.154 ms 1 /classes/module/Module.php:2636
206
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45799 AND `id_group` = 1 LIMIT 1
0.153 ms 0 /classes/GroupReduction.php:156
422
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 45799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:806
506
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ybc_blog" LIMIT 1
0.153 ms 1 /classes/module/Module.php:2636
1186
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68236 LIMIT 1
0.153 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
327
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 57073 AND `id_shop` = 1
0.153 ms 1 /src/Adapter/EntityMapper.php:79
386
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25469 LIMIT 1
0.152 ms 1 /classes/Product.php:1106
123
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 54720
AND image_shop.`cover` = 1 LIMIT 1
0.152 ms 1 /classes/Product.php:3570
315
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 58334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:753
886
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 56685) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:453
947
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 60901
0.151 ms 1 /classes/Product.php:2902
977
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 54724) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.151 ms 1 /classes/Product.php:7720
100
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 57073 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6870
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 25478) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:453
373
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:806
1177
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68236 LIMIT 1
0.150 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
359
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 54719 AND `id_shop` = 1
0.149 ms 1 /src/Adapter/EntityMapper.php:79
420
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 45799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:778
520
CREATE TABLE IF NOT EXISTS `uag_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.149 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
837
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25510 AND id_shop=1 LIMIT 1
0.149 ms 1 /classes/Product.php:6870
976
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 54724 AND `id_shop` = 1
0.149 ms 1 /src/Adapter/EntityMapper.php:79
1096
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 54725
0.149 ms 3 /classes/Product.php:3423
37
SELECT SQL_NO_CACHE id_shop
FROM `uag_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.148 ms 1 /classes/ObjectModel.php:1729
261
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.148 ms 1 /classes/Product.php:5655
91
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25448 AND id_shop=1 LIMIT 1
0.148 ms 1 /classes/Product.php:6870
1185
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 68236 AND `id_group` = 0 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
40
SELECT SQL_NO_CACHE id_shop
FROM `uag_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.147 ms 1 /classes/ObjectModel.php:1729
267
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45800) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:453
378
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 25468 LIMIT 1
0.146 ms 1 /classes/Product.php:1106
405
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:753
533
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 19
0.146 ms 1 /src/Adapter/EntityMapper.php:79
1003
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 67889) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.146 ms 1 /classes/Product.php:7720
125
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 54720 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
323
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:778
340
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 56686) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:753
490
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 45803 LIMIT 1
0.145 ms 1 /classes/Product.php:1106
889
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 57043
AND image_shop.`cover` = 1 LIMIT 1
0.145 ms 1 /classes/Product.php:3570
294
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 45803) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.144 ms 1 /classes/stock/StockAvailable.php:453
368
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 25467
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.144 ms 0 /classes/Product.php:1732
846
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45824 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6870
863
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 54725 LIMIT 1
0.144 ms 1 /classes/SpecificPrice.php:435
1152
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 60901
0.144 ms 3 /classes/Product.php:3423
531
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.143 ms 1 /classes/Country.php:252
1032
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171098
0.143 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
265
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45800 AND id_shop=1 LIMIT 1
0.142 ms 1 /classes/Product.php:6870
174
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25470 LIMIT 1
0.142 ms 1 /classes/SpecificPrice.php:435
1121
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 56685 LIMIT 1
0.142 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
271
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.141 ms 1 /classes/Product.php:5655
853
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 54724 LIMIT 1
0.141 ms 1 /classes/SpecificPrice.php:435
275
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45801 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
382
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25468) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
406
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
436
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:778
89
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25448 LIMIT 1
0.140 ms 1 /classes/SpecificPrice.php:435
857
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 54724) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
147
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25467 AND id_shop=1 LIMIT 1
0.139 ms 1 /classes/Product.php:6870
256
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25477 AND `id_group` = 1 LIMIT 1
0.139 ms 0 /classes/GroupReduction.php:156
333
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 57073) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.139 ms 1 /classes/stock/StockAvailable.php:806
999
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 60901) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.139 ms 1 /classes/Product.php:7720
129
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 54720) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.138 ms 1 /classes/stock/StockAvailable.php:453
1180
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 68236
0.138 ms 3 /classes/Product.php:3423
120
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 56811) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.137 ms 1 /classes/stock/StockAvailable.php:453
1193
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.137 ms 1 /classes/module/Module.php:2109
398
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25470) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:806
284
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45802 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
289
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.135 ms 1 /classes/Product.php:5655
381
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25468) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:753
347
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 56811) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:778
1187
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68236)
GROUP BY a0.`id_supplier`
0.135 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
838
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25510 AND `id_group` = 1 LIMIT 1
0.134 ms 0 /classes/GroupReduction.php:156
843
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.134 ms 1 /classes/Product.php:5655
995
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 57043) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.134 ms 1 /classes/Product.php:7720
177
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25470 AND `id_group` = 1 LIMIT 1
0.133 ms 0 /classes/GroupReduction.php:156
203
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45799 LIMIT 1
0.133 ms 1 /classes/SpecificPrice.php:435
309
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28520
AND `active` = 1 LIMIT 1
0.133 ms 1 /classes/Manufacturer.php:316
514
SELECT SQL_NO_CACHE * FROM `uag_image_type`
0.133 ms 8 /classes/ImageType.php:161
852
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.133 ms 1 /classes/Product.php:5655
87
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.132 ms 1 /classes/Product.php:5655
138
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 54719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:453
357
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 54720) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.132 ms 1 /classes/stock/StockAvailable.php:806
414
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25472) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:806
438
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:806
155
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 25468 LIMIT 1
0.131 ms 1 /classes/SpecificPrice.php:435
1190
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.131 ms 1 /classes/module/Module.php:2109
847
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45824 AND `id_group` = 1 LIMIT 1
0.130 ms 0 /classes/GroupReduction.php:156
71
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 58334 LIMIT 1
0.130 ms 1 /classes/SpecificPrice.php:435
280
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.130 ms 1 /classes/Product.php:5655
494
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 45803) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.130 ms 1 /classes/stock/StockAvailable.php:806
92
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25448 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
107
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 56686 LIMIT 1
0.129 ms 1 /classes/SpecificPrice.php:435
182
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.129 ms 1 /classes/Product.php:5655
492
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 45803) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:778
534
SELECT SQL_NO_CACHE id_module as id, active FROM uag_module WHERE name = "gmerchantcenterpro" AND active = 1
0.129 ms 1 /modules/gremarketing/lib/moduleTools.php:398
73
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 58334 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6870
98
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 57073 LIMIT 1
0.128 ms 1 /classes/SpecificPrice.php:435
272
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 45801 LIMIT 1
0.128 ms 1 /classes/SpecificPrice.php:435
428
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.128 ms 1 /classes/stock/StockAvailable.php:778
513
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.128 ms 0 /classes/module/Module.php:2636
79
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 58334 AND `id_group` = 1 LIMIT 1
0.128 ms 0 /classes/GroupReduction.php:156
355
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 54720) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.127 ms 1 /classes/stock/StockAvailable.php:778
530
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.127 ms 1 /classes/Country.php:194
987
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 54726) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.127 ms 1 /classes/Product.php:7720
1172
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 67889 LIMIT 1
0.127 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
124
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.127 ms 1 /classes/Product.php:5655
535
SELECT SQL_NO_CACHE * FROM uag_module_shop WHERE id_module = 109 AND id_shop = 1
0.127 ms 1 /modules/gremarketing/lib/moduleTools.php:403
348
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 56811) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:753
521
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.126 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
360
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 54719
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.125 ms 0 /classes/Product.php:1732
134
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 54719 LIMIT 1
0.124 ms 1 /classes/SpecificPrice.php:435
127
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 54720 AND id_shop=1 LIMIT 1
0.123 ms 1 /classes/Product.php:6870
226
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25474 AND `id_group` = 1 LIMIT 1
0.123 ms 0 /classes/GroupReduction.php:156
374
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8347 LIMIT 1
0.123 ms 0 /classes/Category.php:1378
1021
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.122 ms 1 /classes/module/Module.php:2636
363
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 54719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:778
388
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:778
211
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.121 ms 1 /classes/Product.php:5655
421
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 45799) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:753
205
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45799 AND id_shop=1 LIMIT 1
0.120 ms 1 /classes/Product.php:6870
303
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25478 AND `id_group` = 1 LIMIT 1
0.120 ms 0 /classes/GroupReduction.php:156
371
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25467) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.120 ms 1 /classes/stock/StockAvailable.php:778
292
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45803 AND id_shop=1 LIMIT 1
0.119 ms 1 /classes/Product.php:6870
396
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 25470) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.119 ms 1 /classes/stock/StockAvailable.php:778
540
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 130 AND `id_shop` = 1 LIMIT 1
0.119 ms 1 /classes/module/Module.php:2109
314
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 58334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.117 ms 1 /classes/stock/StockAvailable.php:778
106
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.117 ms 1 /classes/Product.php:5655
884
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 56685 AND id_shop=1 LIMIT 1
0.117 ms 1 /classes/Product.php:6870
1020
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.116 ms 1 /classes/module/Module.php:2109
133
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.116 ms 1 /classes/Product.php:5655
924
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 68236 AND `id_group` = 1 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:156
283
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45802 AND id_shop=1 LIMIT 1
0.113 ms 1 /classes/Product.php:6870
364
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 54719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.113 ms 1 /classes/stock/StockAvailable.php:753
32
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.112 ms 1 /classes/Currency.php:893
923
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 68236 AND id_shop=1 LIMIT 1
0.112 ms 1 /classes/Product.php:6870
1018
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.112 ms 1 /classes/module/Module.php:2109
142
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8347 LIMIT 1
0.111 ms 1 /classes/Category.php:1378
873
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 54726 LIMIT 1
0.111 ms 1 /classes/SpecificPrice.php:435
157
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25468 AND id_shop=1 LIMIT 1
0.111 ms 1 /classes/Product.php:6870
892
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 57043 LIMIT 1
0.111 ms 1 /classes/SpecificPrice.php:435
136
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 54719 AND id_shop=1 LIMIT 1
0.110 ms 1 /classes/Product.php:6870
109
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 56686 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6870
906
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 60901) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.109 ms 1 /classes/stock/StockAvailable.php:453
310
SELECT SQL_NO_CACHE `name` FROM `uag_supplier` WHERE `id_supplier` = 0 LIMIT 1
0.108 ms 0 /classes/Supplier.php:243
536
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenter" LIMIT 1
0.108 ms 0 /classes/module/Module.php:2636
896
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 57043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.108 ms 1 /classes/stock/StockAvailable.php:453
389
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 25469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.107 ms 1 /classes/stock/StockAvailable.php:753
856
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54724 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:156
53
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.104 ms 0 /classes/module/Module.php:2109
365
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 54719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.104 ms 1 /classes/stock/StockAvailable.php:806
502
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25478) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.104 ms 1 /classes/stock/StockAvailable.php:806
274
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 45801 AND id_shop=1 LIMIT 1
0.103 ms 1 /classes/Product.php:6870
390
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 25469) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.103 ms 1 /classes/stock/StockAvailable.php:806
153
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.101 ms 1 /classes/Product.php:5655
266
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45800 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:156
518
CREATE TABLE IF NOT EXISTS `uag_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.099 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
56
SELECT SQL_NO_CACHE `need_identification_number`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.098 ms 1 /classes/Country.php:405
110
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 56686 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:156
128
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54720 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:156
137
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54719 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:156
293
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 45803 AND `id_group` = 1 LIMIT 1
0.098 ms 0 /classes/GroupReduction.php:156
1010
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.098 ms 1 /classes/Category.php:1591
166
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 25469 AND id_shop=1 LIMIT 1
0.097 ms 1 /classes/Product.php:6870
316
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 58334) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.097 ms 1 /classes/stock/StockAvailable.php:806
867
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 54725) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.097 ms 1 /classes/stock/StockAvailable.php:453
904
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 60901 AND id_shop=1 LIMIT 1
0.097 ms 1 /classes/Product.php:6870
875
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 54726 AND id_shop=1 LIMIT 1
0.096 ms 1 /classes/Product.php:6870
900
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.094 ms 1 /classes/Product.php:5655
885
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 56685 AND `id_group` = 1 LIMIT 1
0.093 ms 0 /classes/GroupReduction.php:156
902
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 60901 LIMIT 1
0.093 ms 1 /classes/SpecificPrice.php:435
865
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 54725 AND id_shop=1 LIMIT 1
0.092 ms 1 /classes/Product.php:6870
894
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 57043 AND id_shop=1 LIMIT 1
0.090 ms 1 /classes/Product.php:6870
871
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.089 ms 1 /classes/Product.php:5655
522
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.088 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
890
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.088 ms 1 /classes/Product.php:5655
118
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 56811 AND id_shop=1 LIMIT 1
0.086 ms 1 /classes/Product.php:6870
158
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25468 AND `id_group` = 1 LIMIT 1
0.084 ms 0 /classes/GroupReduction.php:156
866
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54725 AND `id_group` = 1 LIMIT 1
0.083 ms 0 /classes/GroupReduction.php:156
881
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8346 LIMIT 1
0.083 ms 1 /classes/Product.php:5655
356
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 54720) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.081 ms 1 /classes/stock/StockAvailable.php:753
148
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25467 AND `id_group` = 1 LIMIT 1
0.077 ms 0 /classes/GroupReduction.php:156
167
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 25469 AND `id_group` = 1 LIMIT 1
0.077 ms 0 /classes/GroupReduction.php:156
876
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 54726 AND `id_group` = 1 LIMIT 1
0.077 ms 0 /classes/GroupReduction.php:156
143
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8347 LIMIT 1
0.076 ms 1 /classes/Product.php:5655
905
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 60901 AND `id_group` = 1 LIMIT 1
0.075 ms 0 /classes/GroupReduction.php:156
119
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 56811 AND `id_group` = 1 LIMIT 1
0.070 ms 0 /classes/GroupReduction.php:156
515
BEGIN
0.067 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:74
895
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 57043 AND `id_group` = 1 LIMIT 1
0.067 ms 0 /classes/GroupReduction.php:156
523
COMMIT
0.058 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:100

Doubles

266 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX))) GROUP BY fp.id_feature_value
44 queries
			SELECT `reduction`
			FROM `uag_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
35 queries
SELECT XX FROM `uag_specific_price` WHERE id_product = XX LIMIT XX
34 queries
SELECT image_shop.`id_image`
                    FROM `uag_image` i
                     INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
34 queries
SELECT name FROM uag_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
34 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
34 queries
                            SELECT `id_tax_rules_group`
                            FROM `uag_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
34 queries
SELECT SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
34 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `uag_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
34 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM uag_feature_product pf
                LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN uag_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
34 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
34 queries
SELECT *
							FROM `uag_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
34 queries
SELECT product_attribute_shop.id_product_attribute
                FROM uag_product_attribute pa
                 INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
30 queries
SELECT id_manufacturer FROM `uag_product` WHERE id_product = XX LIMIT XX
30 queries
SELECT *
FROM `uag_product_supplier` aXX
WHERE (aXX.`id_product` = XX)
GROUP BY aXX.`id_supplier`
30 queries
                 SELECT gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "XX-XX-XX XX:XX:XX" OR date_from = "XX-XX-XX XX:XX:XX") AND (date_to >= "XX-XX-XX XX:XX:XX" OR date_to = "XX-XX-XX XX:XX:XX") AND gi.`id_shop` = XX AND gi.`active` = XX  AND (gi.groups = ""  OR FIND_IN_SET(XX, REPLACE(gi.groups, ";", ",")) > XX) AND (gi.manufacturers = "" OR FIND_IN_SET(XX, REPLACE(gi.manufacturers, ";", ",")) > XX) AND (gi.suppliers = "" ) ORDER BY position, priority
24 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
24 queries
SELECT COUNT(p.id_product)
            FROM `uag_product` p
             INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
            WHERE p.id_product = XX
            AND DATEDIFF("XX-XX-XX XX:XX:XX", product_shop.`date_add`) < XX LIMIT XX
24 queries
        SELECT t.`id_lang`, t.`name`
        FROM uag_tag t
        LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
        WHERE pt.`id_product`=XX
24 queries
SELECT out_of_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
17 queries
SELECT `id_module` FROM `uag_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
10 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `uag_image` i
             INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
10 queries
SELECT `id_product_attribute`
            FROM `uag_product_attribute`
            WHERE `id_product` = XX
10 queries
SELECT DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = XX) AND (pl.id_lang = XX AND pl.id_shop = XX ) LIMIT XX
10 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `uag_iqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
10 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `uag_product_attribute` pa
             INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
10 queries
                SELECT `id_category` FROM `uag_category_product`
                WHERE `id_product` = XX
10 queries
                SELECT fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
                FROM `uag_feature_product` fp
                LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
                WHERE `id_product` = XX
6 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
6 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
6 queries
SELECT *
							FROM `uag_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
5 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `uag_module` m
                LEFT JOIN `uag_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
5 queries
SELECT a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = XX)
WHERE (a.`id_lgcookieslaw_purpose` = XX) AND (a.`id_shop` = XX) AND (a.`active` = XX)
ORDER BY a.`name`
4 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
4 queries
			SELECT cl.`link_rewrite`
			FROM `uag_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
4 queries
				SELECT tr.*
				FROM `uag_tax_rule` tr
				JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = XX
 INNER JOIN uag_supplier_shop supplier_shop
        ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = XX)
WHERE (s.`active` = XX)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
2 queries
SELECT `id_lang` FROM `uag_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `uag_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `uag_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `uag_country_lang`
							WHERE `id_country` = XX
2 queries
SELECT a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = XX)
WHERE (a.`id_shop` = XX) AND (a.`active` = XX)
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, XX) AS id_product_attribute,
					product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
					pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
					il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
					DATEDIFF(product_shop.`date_add`, DATE_SUB("XX-XX-XX XX:XX:XX",
					INTERVAL XX DAY)) > XX AS new, product_shop.price AS orderprice
				FROM `uag_category_product` cp
				LEFT JOIN `uag_product` p
					ON p.`id_product` = cp.`id_product`
				 INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
				ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = XX AND product_attribute_shop.id_shop=XX)
				 LEFT JOIN uag_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = XX AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
				LEFT JOIN `uag_category_lang` cl
					ON (product_shop.`id_category_default` = cl.`id_category`
					AND cl.`id_lang` = XX AND cl.id_shop = XX )
				LEFT JOIN `uag_product_lang` pl
					ON (p.`id_product` = pl.`id_product`
					AND pl.`id_lang` = XX AND pl.id_shop = XX )
				LEFT JOIN `uag_image_shop` image_shop
					ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=XX AND image_shop.id_shop=XX)
				LEFT JOIN `uag_image_lang` il
					ON (image_shop.`id_image` = il.`id_image`
					AND il.`id_lang` = XX)
				LEFT JOIN `uag_manufacturer` m
					ON m.`id_manufacturer` = p.`id_manufacturer`
				WHERE product_shop.`id_shop` = XX
					AND cp.`id_category` = XX AND product_shop.`active` = XX AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
			LIMIT XX,XX
2 queries
			SELECT `reduction`
			FROM `uag_group`
			WHERE `id_group` = XX LIMIT XX
2 queries
							SELECT `name`
							FROM `uag_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright`  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright` FROM `uag_category` c
            WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.*, cl.*  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
2 queries
DELETE FROM `uag_feedaty_cache` WHERE expiration < XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_widgets" LIMIT XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_analytics" LIMIT XX

Tables stress

857 feature_product
459 product
429 product_shop
387 stock_available
331 product_attribute
297 category
289 category_product
287 product_attribute_combination
279 category_group
274 product_sale
80 product_attribute_shop
71 product_lang
69 cart_product
59 category_lang
46 image_shop
44 image
44 product_group_reduction_cache
40 feature_value_lang
36 feature
36 feature_shop
36 feature_lang
35 specific_price
34 pack
31 module
31 multipleprices_configuration
30 product_supplier
24 module_shop
24 tag
24 product_tag
16 feature_value
15 category_shop
12 image_lang
10 iqitreviews_products
10 attribute
10 attribute_lang
10 attribute_group
7 country
7 hook
6 currency
6 layered_indexable_feature_value_lang_value
6 feedaty_cache
5 lang
5 country_lang
5 group
5 lgcookieslaw_cookie
5 lgcookieslaw_cookie_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 manufacturer
4 tax_rule
4 tax_rules_group
3 country_shop
3 hook_alias
3 supplier
3 group_lang
3 group_shop
3 gmcp_feeds
2 shop_group
2 configuration
2 hook_module
2 supplier_lang
2 supplier_shop
2 currency_lang
2 cart_rule_lang
2 image_type
2 lgcookieslaw_purpose
2 lgcookieslaw_purpose_lang
2 iqit_elementor_category
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 revslider_sliders
1 tax
1 tax_lang
1 gap_refund
1 gap_refund_partial
1 ets_abancart_campaign
1 ets_abancart_campaign_country
1 ets_abancart_campaign_with_lang
1 ets_abancart_campaign_group
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 feature_flag
1 iqit_elementor_category_shop
1 multipleprices_configuration_lang
1 cms
1 cms_lang
1 cms_shop
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Product 120 /classes/Link.php:113 (__construct) [id: 58334]
/classes/Link.php:113 (__construct) [id: 25448]
/classes/Link.php:113 (__construct) [id: 25467]
/classes/Link.php:113 (__construct) [id: 25468]
/classes/Link.php:113 (__construct) [id: 25470]
/classes/Link.php:113 (__construct) [id: 25471]
/classes/Link.php:113 (__construct) [id: 25472]
/classes/Link.php:113 (__construct) [id: 25473]
/classes/Link.php:113 (__construct) [id: 25474]
/classes/Link.php:113 (__construct) [id: 25475]
/classes/Link.php:113 (__construct) [id: 25476]
/classes/Link.php:113 (__construct) [id: 25477]
/classes/Link.php:113 (__construct) [id: 45800]
/classes/Link.php:113 (__construct) [id: 25478]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 58334]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25448]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 57073]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 56686]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 56811]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 54720]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 54719]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25467]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25468]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25469]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25470]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25471]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25472]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 45799]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25473]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25474]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25475]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25476]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25477]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 45800]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 45801]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 45802]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 45803]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 25478]
/classes/Link.php:113 (__construct) [id: 25510]
/classes/Link.php:113 (__construct) [id: 54725]
/classes/Link.php:113 (__construct) [id: 54726]
/classes/Link.php:113 (__construct) [id: 57043]
/classes/Link.php:113 (__construct) [id: 60901]
/classes/Link.php:113 (__construct) [id: 68236]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25510]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 45824]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 54724]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 54725]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 54726]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 56685]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 57043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 60901]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 67889]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 68236]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 25510]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 25510]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 45824]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 45824]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54724]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54724]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54725]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54725]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54726]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 54726]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 56685]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 56685]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 57043]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 57043]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 60901]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 60901]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 67889]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 67889]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 68236]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 68236]
/classes/Link.php:113 (__construct) [id: 25510]
/classes/Link.php:113 (__construct) [id: 54725]
/classes/Link.php:113 (__construct) [id: 54726]
/classes/Link.php:113 (__construct) [id: 57043]
/classes/Link.php:113 (__construct) [id: 60901]
/classes/Link.php:113 (__construct) [id: 68236]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 25510]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 25510]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 25510]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 25510]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 45824]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 45824]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 45824]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 45824]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 54724]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54724]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54724]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54724]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 54725]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54725]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54725]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54725]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 54726]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54726]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54726]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 54726]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 56685]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 56685]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 56685]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 56685]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 57043]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 57043]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 57043]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 57043]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 60901]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 60901]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 60901]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 60901]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 67889]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 67889]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 67889]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 67889]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 68236]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68236]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68236]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68236]
Category 116 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 7928]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8346]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8347]
/classes/Meta.php:380 (__construct) [id: 7928]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ganalyticspro/lib/gtag/categoryTag.php:33 (__construct) [id: 7928]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7928]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8346]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8347]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7928]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:64 (__construct) [id: 7928]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:171 (__construct) [id: 7928]
/modules/connettore/connettore.php:490 (__construct) [id: 7928]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 7928]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8347]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1338 (__construct) [id: 2]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8347]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8347]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8346]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7848]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7928]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 7928]
Address 70 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5958 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
Cart 34 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Configuration 32 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 32 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
OrderState 32 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
MultiplepricesConfiguration 10 /modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
Language 6 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/ganalyticspro/lib/gtag/categoryTag.php:52 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:139 (__construct) [id: 1]
Country 6 /config/config.inc.php:146 (__construct) [id: 10]
/classes/controller/FrontController.php:354 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1767 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 19]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:695 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:211 (__construct) [id: 1]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Group 2 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:370 (__construct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 234]
/classes/controller/FrontController.php:1766 (__construct) [id: 234]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
CMS 1 /classes/Link.php:555 (__construct) [id: 3]
AddressFormat 1 /classes/controller/FrontController.php:1761 (generateAddress) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1694 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1691 (__construct) [id: 0]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/ircmaxell/password-compat/lib/password.php
40 /vendor/api-platform/core/src/deprecation.php
41 /vendor/api-platform/core/src/Api/FilterInterface.php
42 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
43 /vendor/api-platform/core/src/deprecated_interfaces.php
44 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
46 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
56 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
58 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
59 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
61 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
62 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
63 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
65 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
66 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
67 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
68 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
69 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
70 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
71 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
72 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
73 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
74 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
75 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
76 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
77 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
78 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
79 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
86 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
90 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
94 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
97 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
98 /vendor/psr/container/src/ContainerInterface.php
99 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /override/classes/Configuration.php
134 /classes/Configuration.php
135 /classes/Validate.php
136 /classes/cache/Cache.php
137 /src/Adapter/EntityMapper.php
138 /classes/db/DbQuery.php
139 /src/Core/Addon/Theme/ThemeManagerBuilder.php
140 /vendor/psr/log/Psr/Log/NullLogger.php
141 /vendor/psr/log/Psr/Log/AbstractLogger.php
142 /vendor/psr/log/Psr/Log/LoggerInterface.php
143 /src/Adapter/Configuration.php
144 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
145 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
146 /src/Core/ConfigurationInterface.php
147 /src/Core/Addon/Theme/ThemeRepository.php
148 /src/Core/Addon/AddonRepositoryInterface.php
149 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
150 /src/Core/Addon/Theme/Theme.php
151 /src/Core/Addon/AddonInterface.php
152 /src/Core/Util/File/YamlParser.php
153 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
154 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
155 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
157 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
158 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
159 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
160 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
161 /var/cache/prod/yaml/84a464d0176e3f6031f8e8ec956aa9cf.php
162 /src/Core/Util/ArrayFinder.php
163 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
164 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
165 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
166 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
167 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
168 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
169 /config/defines_uri.inc.php
170 /classes/Language.php
171 /src/Core/Language/LanguageInterface.php
172 /classes/Country.php
173 /classes/PrestaShopCollection.php
174 /classes/shop/ShopGroup.php
175 /classes/Cookie.php
176 /classes/PhpEncryption.php
177 /classes/PhpEncryptionEngine.php
178 /vendor/defuse/php-encryption/src/Key.php
179 /vendor/defuse/php-encryption/src/Encoding.php
180 /vendor/defuse/php-encryption/src/Core.php
181 /src/Core/Session/SessionHandler.php
182 /src/Core/Session/SessionHandlerInterface.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
197 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
198 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
199 /config/smarty.config.inc.php
200 /vendor/smarty/smarty/libs/Smarty.class.php
201 /vendor/smarty/smarty/libs/functions.php
202 /vendor/smarty/smarty/libs/Autoloader.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
212 /config/smartyfront.config.inc.php
213 /classes/Smarty/SmartyResourceModule.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
215 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
216 /classes/Smarty/SmartyResourceParent.php
217 /classes/Smarty/SmartyLazyRegister.php
218 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
219 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
220 /classes/Customer.php
221 /classes/Group.php
222 /override/classes/Link.php
223 /classes/Link.php
224 /classes/shop/ShopUrl.php
225 /override/classes/Dispatcher.php
226 /classes/Dispatcher.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
232 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
233 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
234 /src/Adapter/SymfonyContainer.php
235 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
236 /config/db_slave_server.inc.php
237 /modules/doofinder/doofinder.php
238 /modules/doofinder/lib/dfTools.class.php
239 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
241 /classes/Translate.php
242 /modules/doofinder/translations/it.php
243 /src/PrestaShopBundle/Translation/TranslatorComponent.php
244 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
246 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
247 /vendor/symfony/contracts/Translation/TranslatorInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
249 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
250 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
258 /vendor/symfony/contracts/Translation/TranslatorTrait.php
259 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
261 /var/cache/prod/translations/catalogue.it-IT.NXhscRe.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
264 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
265 /modules/ybc_blog/ybc_blog.php
266 /modules/ybc_blog/classes/ybc_blog_category_class.php
267 /modules/ybc_blog/classes/ybc_blog_post_class.php
268 /modules/ybc_blog/classes/ybc_blog_paggination_class.php
269 /modules/ybc_blog/classes/ybc_blog_comment_class.php
270 /modules/ybc_blog/classes/ybc_blog_reply_class.php
271 /modules/ybc_blog/classes/ybc_blog_polls_class.php
272 /modules/ybc_blog/classes/ybc_blog_slide_class.php
273 /modules/ybc_blog/classes/ybc_blog_gallery_class.php
274 /modules/ybc_blog/classes/ybc_blog_link_class.php
275 /modules/ybc_blog/classes/ybc_blog_employee_class.php
276 /modules/ybc_blog/classes/ybc_blog_email_template_class.php
277 /modules/ybc_blog/classes/ImportExport.php
278 /modules/ybc_blog/classes/ybc_browser.php
279 /modules/ybc_blog/ybc_blog_defines.php
280 /modules/ybc_blog/classes/ybc_chatgpt.php
281 /modules/ybc_blog/classes/ybc_chatgpt_message.php
282 /modules/ybc_blog/src/FormType/DescriptionType.php
283 /src/PrestaShopBundle/Form/Admin/Sell/Product/Description/DescriptionType.php
284 /src/PrestaShopBundle/Form/Admin/Type/TranslatorAwareType.php
285 /src/PrestaShopBundle/Form/Admin/Type/CommonAbstractType.php
286 /vendor/symfony/symfony/src/Symfony/Component/Form/AbstractType.php
287 /vendor/symfony/symfony/src/Symfony/Component/Form/FormTypeInterface.php
288 /modules/ybc_blog/translations/it.php
289 /modules/simpleimportproduct/simpleimportproduct.php
290 /modules/simpleimportproduct/classes/mpmTools.php
291 /modules/simpleimportproduct/translations/it.php
292 /classes/Supplier.php
293 /override/classes/Feature.php
294 /classes/Feature.php
295 /modules/ets_abandonedcart/ets_abandonedcart.php
296 /modules/ets_abandonedcart/classes/EtsAbancartCore.php
297 /modules/ets_abandonedcart/classes/EtsAbancartCache.php
298 /modules/ets_abandonedcart/classes/EtsAbancartValidate.php
299 /modules/ets_abandonedcart/classes/EtsAbancartTools.php
300 /modules/ets_abandonedcart/classes/EtsAbancartMail.php
301 /classes/Mail.php
302 /modules/ets_abandonedcart/classes/EtsAbancartIndex.php
303 /modules/ets_abandonedcart/classes/EtsAbancartIndexCustomer.php
304 /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php
305 /modules/ets_abandonedcart/classes/EtsAbancartReminder.php
306 /modules/ets_abandonedcart/classes/EtsAbancartEmailTemplate.php
307 /modules/ets_abandonedcart/classes/EtsAbancartTracking.php
308 /modules/ets_abandonedcart/classes/EtsAbancartDisplayTracking.php
309 /modules/ets_abandonedcart/classes/EtsAbancartReminderForm.php
310 /modules/ets_abandonedcart/classes/EtsAbancartQueue.php
311 /modules/ets_abandonedcart/classes/EtsAbancartShoppingCart.php
312 /modules/ets_abandonedcart/classes/EtsAbancartUnsubscribers.php
313 /modules/ets_abandonedcart/classes/EtsAbancartDefines.php
314 /modules/ets_abandonedcart/classes/EtsAbancartForm.php
315 /modules/ets_abandonedcart/classes/EtsAbancartFormSubmit.php
316 /modules/ets_abandonedcart/classes/EtsAbancartField.php
317 /modules/ets_abandonedcart/classes/EtsAbancartFieldValue.php
318 /modules/ets_abandonedcart/translations/it.php
319 /controllers/front/listing/CategoryController.php
320 /classes/controller/ProductListingFrontController.php
321 /classes/controller/ProductPresentingFrontController.php
322 /classes/controller/FrontController.php
323 /src/Adapter/Presenter/Object/ObjectPresenter.php
324 /src/Adapter/Presenter/PresenterInterface.php
325 /src/Adapter/Presenter/Cart/CartPresenter.php
326 /src/Adapter/Product/PriceFormatter.php
327 /src/Adapter/Image/ImageRetriever.php
328 /classes/tax/TaxConfiguration.php
329 /classes/Smarty/TemplateFinder.php
330 /classes/assets/StylesheetManager.php
331 /classes/assets/AbstractAssetManager.php
332 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
333 /classes/assets/JavascriptManager.php
334 /classes/assets/CccReducer.php
335 /modules/iqitthemeeditor/iqitthemeeditor.php
336 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
337 /modules/iqitthemeeditor/translations/it.php
338 /override/classes/Category.php
339 /classes/Category.php
340 /classes/webservice/WebserviceRequest.php
341 /src/Adapter/ContainerBuilder.php
342 /src/Adapter/Environment.php
343 /src/Core/EnvironmentInterface.php
344 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
345 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
346 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
347 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
348 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
349 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
350 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
351 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
352 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
353 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
354 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
355 /vendor/symfony/contracts/Service/ResetInterface.php
356 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
357 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
358 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
359 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
360 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
361 /vendor/symfony/contracts/Cache/ItemInterface.php
362 /vendor/psr/cache/src/CacheItemInterface.php
363 /vendor/psr/cache/src/CacheItemPoolInterface.php
364 /vendor/symfony/contracts/Cache/CacheInterface.php
365 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
367 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
369 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
370 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
371 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
372 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
373 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
374 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
389 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
390 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
391 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
392 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
393 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
396 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
397 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
398 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
399 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
400 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
401 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
402 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
403 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
404 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
405 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
406 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
407 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
408 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
409 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
410 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
411 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
412 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
413 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
414 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
415 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
416 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
417 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
418 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
419 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
420 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
421 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
422 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
423 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
424 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
425 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
426 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
427 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
428 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
429 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
430 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
431 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
432 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
433 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
434 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
435 /var/cache/prod/FrontContainer.php
436 /src/Adapter/Container/LegacyContainer.php
437 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
438 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
439 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
440 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
441 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
442 /vendor/psr/container/src/ContainerExceptionInterface.php
443 /vendor/psr/container/src/NotFoundExceptionInterface.php
444 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
445 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
446 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
447 /src/Adapter/Container/LegacyContainerInterface.php
448 /modules/ps_shoppingcart/vendor/autoload.php
449 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
450 /modules/ps_shoppingcart/vendor/composer/platform_check.php
451 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
452 /modules/ps_emailsubscription/vendor/autoload.php
453 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
454 /modules/ps_emailsubscription/vendor/composer/platform_check.php
455 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
456 /modules/productcomments/vendor/autoload.php
457 /modules/productcomments/vendor/composer/autoload_real.php
458 /modules/productcomments/vendor/composer/platform_check.php
459 /modules/productcomments/vendor/composer/autoload_static.php
460 /modules/ps_facetedsearch/vendor/autoload.php
461 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
462 /modules/ps_facetedsearch/vendor/composer/platform_check.php
463 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
464 /modules/contactform/vendor/autoload.php
465 /modules/contactform/vendor/composer/autoload_real.php
466 /modules/contactform/vendor/composer/platform_check.php
467 /modules/contactform/vendor/composer/autoload_static.php
468 /modules/ps_emailalerts/vendor/autoload.php
469 /modules/ps_emailalerts/vendor/composer/autoload_real.php
470 /modules/ps_emailalerts/vendor/composer/platform_check.php
471 /modules/ps_emailalerts/vendor/composer/autoload_static.php
472 /modules/ps_checkpayment/vendor/autoload.php
473 /modules/ps_checkpayment/vendor/composer/autoload_real.php
474 /modules/ps_checkpayment/vendor/composer/platform_check.php
475 /modules/ps_checkpayment/vendor/composer/autoload_static.php
476 /modules/ps_wirepayment/vendor/autoload.php
477 /modules/ps_wirepayment/vendor/composer/autoload_real.php
478 /modules/ps_wirepayment/vendor/composer/platform_check.php
479 /modules/ps_wirepayment/vendor/composer/autoload_static.php
480 /modules/statscheckup/vendor/autoload.php
481 /modules/statscheckup/vendor/composer/autoload_real.php
482 /modules/statscheckup/vendor/composer/platform_check.php
483 /modules/statscheckup/vendor/composer/autoload_static.php
484 /modules/statscatalog/vendor/autoload.php
485 /modules/statscatalog/vendor/composer/autoload_real.php
486 /modules/statscatalog/vendor/composer/platform_check.php
487 /modules/statscatalog/vendor/composer/autoload_static.php
488 /modules/dashactivity/vendor/autoload.php
489 /modules/dashactivity/vendor/composer/autoload_real.php
490 /modules/dashactivity/vendor/composer/platform_check.php
491 /modules/dashactivity/vendor/composer/autoload_static.php
492 /modules/dashproducts/vendor/autoload.php
493 /modules/dashproducts/vendor/composer/autoload_real.php
494 /modules/dashproducts/vendor/composer/platform_check.php
495 /modules/dashproducts/vendor/composer/autoload_static.php
496 /modules/dashtrends/vendor/autoload.php
497 /modules/dashtrends/vendor/composer/autoload_real.php
498 /modules/dashtrends/vendor/composer/platform_check.php
499 /modules/dashtrends/vendor/composer/autoload_static.php
500 /modules/ps_distributionapiclient/vendor/autoload.php
501 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
502 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
503 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
504 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
505 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
506 /modules/pagesnotfound/vendor/autoload.php
507 /modules/pagesnotfound/vendor/composer/autoload_real.php
508 /modules/pagesnotfound/vendor/composer/platform_check.php
509 /modules/pagesnotfound/vendor/composer/autoload_static.php
510 /modules/statsproduct/vendor/autoload.php
511 /modules/statsproduct/vendor/composer/autoload_real.php
512 /modules/statsproduct/vendor/composer/platform_check.php
513 /modules/statsproduct/vendor/composer/autoload_static.php
514 /modules/ps_themecusto/vendor/autoload.php
515 /modules/ps_themecusto/vendor/composer/autoload_real.php
516 /modules/ps_themecusto/vendor/composer/platform_check.php
517 /modules/ps_themecusto/vendor/composer/autoload_static.php
518 /modules/ps_checkout/vendor/autoload.php
519 /modules/ps_checkout/vendor/composer/autoload_real.php
520 /modules/ps_checkout/vendor/composer/platform_check.php
521 /modules/ps_checkout/vendor/composer/autoload_static.php
522 /modules/ps_checkout/vendor/clue/stream-filter/src/functions_include.php
523 /modules/ps_checkout/vendor/clue/stream-filter/src/functions.php
524 /modules/ps_checkout/vendor/php-http/message/src/filters.php
525 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
526 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment.php
527 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Client.php
528 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
529 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
530 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
531 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
532 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
533 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
534 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Version.php
535 /modules/ps_accounts/vendor/autoload.php
536 /modules/ps_accounts/vendor/composer/autoload_real.php
537 /modules/ps_accounts/vendor/composer/platform_check.php
538 /modules/ps_accounts/vendor/composer/autoload_static.php
539 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
540 /modules/ps_accounts/vendor/symfony/polyfill-php70/bootstrap.php
541 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions_include.php
542 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions.php
543 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions_include.php
544 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions.php
545 /modules/ps_accounts/vendor/symfony/polyfill-apcu/bootstrap.php
546 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions_include.php
547 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions.php
548 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
549 /modules/gmerchantcenterpro/vendor/autoload.php
550 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
551 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
552 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
553 /modules/ganalyticspro/vendor/autoload.php
554 /modules/ganalyticspro/vendor/composer/autoload_real.php
555 /modules/ganalyticspro/vendor/composer/platform_check.php
556 /modules/ganalyticspro/vendor/composer/autoload_static.php
557 /modules/fattura24/vendor/autoload.php
558 /modules/fattura24/vendor/composer/autoload_real.php
559 /modules/fattura24/vendor/composer/autoload_static.php
560 /modules/payplug/vendor/autoload.php
561 /modules/payplug/vendor/composer/autoload_real.php
562 /modules/payplug/vendor/composer/autoload_static.php
563 /modules/sendinblue/vendor/autoload.php
564 /modules/sendinblue/vendor/composer/autoload_real.php
565 /modules/sendinblue/vendor/composer/platform_check.php
566 /modules/sendinblue/vendor/composer/autoload_static.php
567 /modules/gremarketing/vendor/autoload.php
568 /modules/gremarketing/vendor/composer/autoload_real.php
569 /modules/gremarketing/vendor/composer/platform_check.php
570 /modules/gremarketing/vendor/composer/autoload_static.php
571 /modules/feedaty/vendor/autoload.php
572 /modules/feedaty/vendor/composer/autoload_real.php
573 /modules/feedaty/vendor/composer/autoload_static.php
574 /modules/seoimg/vendor/autoload.php
575 /modules/seoimg/vendor/composer/autoload_real.php
576 /modules/seoimg/vendor/composer/platform_check.php
577 /modules/seoimg/vendor/composer/autoload_static.php
578 /modules/psrecaptcha/vendor/autoload.php
579 /modules/psrecaptcha/vendor/composer/autoload_real.php
580 /modules/psrecaptcha/vendor/composer/platform_check.php
581 /modules/psrecaptcha/vendor/composer/autoload_static.php
582 /modules/autoupgrade/vendor/autoload.php
583 /modules/autoupgrade/vendor/composer/autoload_real.php
584 /modules/autoupgrade/vendor/composer/autoload_static.php
585 /modules/lgcookieslaw/vendor/autoload.php
586 /modules/lgcookieslaw/vendor/composer/autoload_real.php
587 /modules/lgcookieslaw/vendor/composer/autoload_static.php
588 /src/Core/Localization/Locale/Repository.php
589 /src/Core/Localization/Locale/RepositoryInterface.php
590 /src/Core/Localization/CLDR/LocaleRepository.php
591 /src/Core/Localization/CLDR/LocaleDataSource.php
592 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
593 /src/Core/Data/Layer/AbstractDataLayer.php
594 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
595 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
596 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
597 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
598 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
599 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
600 /vendor/symfony/contracts/Cache/CacheTrait.php
601 /vendor/psr/cache/src/InvalidArgumentException.php
602 /vendor/psr/cache/src/CacheException.php
603 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
604 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
605 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
606 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
607 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
608 /src/Core/Localization/CLDR/Reader.php
609 /src/Core/Localization/CLDR/ReaderInterface.php
610 /src/Core/Localization/Currency/Repository.php
611 /src/Core/Localization/Currency/RepositoryInterface.php
612 /src/Core/Localization/Currency/CurrencyDataSource.php
613 /src/Core/Localization/Currency/DataSourceInterface.php
614 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
615 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
616 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
617 /src/Adapter/Currency/CurrencyDataProvider.php
618 /src/Core/Currency/CurrencyDataProviderInterface.php
619 /src/Adapter/LegacyContext.php
620 /src/Adapter/Tools.php
621 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
622 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
623 /vendor/prestashop/decimal/src/Operation/Rounding.php
624 /src/Core/Localization/Locale.php
625 /src/Core/Localization/LocaleInterface.php
626 /src/Core/Localization/Specification/Price.php
627 /src/Core/Localization/Specification/Number.php
628 /src/Core/Localization/Specification/NumberInterface.php
629 /src/Core/Localization/Specification/Factory.php
630 /src/Core/Localization/CLDR/LocaleData.php
631 /src/Core/Localization/CLDR/NumberSymbolsData.php
632 /src/Core/Localization/CLDR/CurrencyData.php
633 /src/Core/Localization/CLDR/Locale.php
634 /src/Core/Localization/CLDR/LocaleInterface.php
635 /src/Core/Localization/Specification/NumberSymbolList.php
636 /classes/Currency.php
637 /src/Core/Localization/Currency/LocalizedCurrencyId.php
638 /src/Core/Localization/Currency/CurrencyData.php
639 /src/Core/Localization/Currency/CurrencyCollection.php
640 /src/Core/Localization/Currency.php
641 /src/Core/Localization/CurrencyInterface.php
642 /src/Core/Localization/Specification/NumberCollection.php
643 /src/Core/Localization/Number/Formatter.php
644 /classes/Cart.php
645 /src/Adapter/AddressFactory.php
646 /classes/CartRule.php
647 /override/classes/Product.php
648 /classes/Product.php
649 /src/Core/Domain/Product/ValueObject/RedirectType.php
650 /src/Core/Util/DateTime/DateTime.php
651 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
652 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
653 /src/Core/Domain/Product/ValueObject/ProductType.php
654 /src/Core/Domain/Product/ValueObject/Reference.php
655 /src/Core/Domain/Product/ValueObject/Ean13.php
656 /src/Core/Domain/Product/ValueObject/Isbn.php
657 /src/Core/Domain/Product/ValueObject/Upc.php
658 /src/Core/Domain/Product/ProductSettings.php
659 /src/Core/Domain/Shop/ValueObject/ShopId.php
660 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
661 /modules/ps_emailsubscription/ps_emailsubscription.php
662 /src/Core/Module/WidgetInterface.php
663 /src/PrestaShopBundle/Translation/DomainNormalizer.php
664 /classes/Media.php
665 /modules/ps_emailalerts/ps_emailalerts.php
666 /modules/ps_emailalerts/MailAlert.php
667 /modules/ps_checkout/ps_checkout.php
668 /classes/PaymentModule.php
669 /modules/ps_checkout/translations/it.php
670 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
671 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
672 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
673 /var/cache/prod/Ps_checkout8400FrontContainer.php
674 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
675 /modules/ps_checkout/src/Validator/MerchantValidator.php
676 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
677 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
678 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
679 /modules/ps_checkout/src/Shop/ShopProvider.php
680 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
681 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
682 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
683 /modules/ps_checkout/src/Repository/PsAccountRepository.php
684 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
685 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
686 /src/Core/Addon/Module/ModuleManagerBuilder.php
687 /var/cache/prod/yaml/1deb99a1745c58282b5926d8d607faaa.php
688 /src/Adapter/LegacyLogger.php
689 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
690 /src/Adapter/Module/ModuleDataProvider.php
691 /src/Adapter/Module/AdminModuleDataProvider.php
692 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
693 /src/Adapter/Module/Module.php
694 /src/Core/Module/ModuleInterface.php
695 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
696 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
697 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
698 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
699 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
700 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
701 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
702 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
703 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
704 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
705 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
706 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
707 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
708 /src/Adapter/Module/ModuleDataUpdater.php
709 /src/Core/Module/ModuleManager.php
710 /src/Core/Module/ModuleManagerInterface.php
711 /src/Core/Module/ModuleRepository.php
712 /src/Core/Module/ModuleRepositoryInterface.php
713 /src/Adapter/HookManager.php
714 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
715 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
716 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
717 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
718 /modules/ps_distributionapiclient/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
719 /src/Core/Hook/HookDispatcherInterface.php
720 /modules/ps_accounts/ps_accounts.php
721 /modules/ps_accounts/src/Hook/HookableTrait.php
722 /modules/ps_accounts/src/Module/Install.php
723 /modules/ps_accounts/translations/it.php
724 /modules/ps_accounts/src/DependencyInjection/ServiceContainer.php
725 /modules/ps_accounts/src/DependencyInjection/ContainerProvider.php
726 /var/cache/prod/Ps_accounts701FrontContainer.php
727 /modules/ps_accounts/src/Service/PsAccountsService.php
728 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
729 /modules/ps_accounts/src/Account/Session/Session.php
730 /modules/ps_accounts/src/Account/Session/SessionInterface.php
731 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
732 /modules/ps_accounts/src/Adapter/Configuration.php
733 /modules/ps_accounts/src/Account/Session/ShopSession.php
734 /modules/ps_accounts/src/Account/Session/RefreshFirebaseTokens.php
735 /modules/ps_accounts/src/Provider/OAuth2/ShopProvider.php
736 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/PrestaShop.php
737 /modules/ps_accounts/vendor/league/oauth2-client/src/Provider/AbstractProvider.php
738 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/ArrayAccessorTrait.php
739 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/GuardedPropertyTrait.php
740 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/QueryBuilderTrait.php
741 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/BearerAuthorizationTrait.php
742 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/LogoutTrait.php
743 /modules/ps_accounts/src/Provider/OAuth2/Oauth2Client.php
744 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
745 /modules/ps_accounts/src/Type/Enum.php
746 /modules/ps_accounts/src/Adapter/Link.php
747 /modules/ps_accounts/src/Context/ShopContext.php
748 /modules/ps_accounts/vendor/league/oauth2-client/src/Grant/GrantFactory.php
749 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/RequestFactory.php
750 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Client.php
751 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/ClientInterface.php
752 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/HandlerStack.php
753 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/Proxy.php
754 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlMultiHandler.php
755 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactory.php
756 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactoryInterface.php
757 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlHandler.php
758 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/StreamHandler.php
759 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Middleware.php
760 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/RedirectMiddleware.php
761 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/PostAuthOptionProvider.php
762 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/OptionProviderInterface.php
763 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
764 /modules/ps_accounts/src/Account/LinkShop.php
765 /modules/ps_checkout/src/Context/PrestaShopContext.php
766 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
767 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
768 /modules/ps_checkout/src/Version/Version.php
769 /modules/psrecaptcha/psrecaptcha.php
770 /modules/psrecaptcha/translations/it.php
771 /classes/ProductDownload.php
772 /classes/tax/Tax.php
773 /src/Core/Localization/CLDR/ComputingPrecision.php
774 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
775 /src/Core/Cart/Calculator.php
776 /src/Core/Cart/CartRowCollection.php
777 /src/Core/Cart/Fees.php
778 /src/Core/Cart/AmountImmutable.php
779 /src/Core/Cart/CartRuleCollection.php
780 /src/Core/Cart/CartRuleCalculator.php
781 /src/Adapter/Product/PriceCalculator.php
782 /classes/order/Order.php
783 /src/Core/Cart/CartRow.php
784 /vendor/prestashop/decimal/src/DecimalNumber.php
785 /vendor/prestashop/decimal/src/Builder.php
786 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
787 /classes/Gender.php
788 /classes/Risk.php
789 /classes/Meta.php
790 /modules/revsliderprestashop/revsliderprestashop.php
791 /modules/revsliderprestashop/rev-loader.php
792 /modules/revsliderprestashop/includes/revslider_db.class.php
793 /modules/revsliderprestashop/includes/data.class.php
794 /modules/revsliderprestashop/includes/functions.class.php
795 /modules/revsliderprestashop/includes/em-integration.class.php
796 /modules/revsliderprestashop/includes/cssparser.class.php
797 /modules/revsliderprestashop/includes/woocommerce.class.php
798 /modules/revsliderprestashop/includes/wpml.class.php
799 /modules/revsliderprestashop/includes/colorpicker.class.php
800 /modules/revsliderprestashop/includes/navigation.class.php
801 /modules/revsliderprestashop/includes/object-library.class.php
802 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
803 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
804 /modules/revsliderprestashop/includes/extension.class.php
805 /modules/revsliderprestashop/includes/favorite.class.php
806 /modules/revsliderprestashop/includes/aq-resizer.class.php
807 /modules/revsliderprestashop/includes/external-sources.class.php
808 /modules/revsliderprestashop/includes/page-template.class.php
809 /modules/revsliderprestashop/includes/slider.class.php
810 /modules/revsliderprestashop/includes/slide.class.php
811 /modules/revsliderprestashop/includes/output.class.php
812 /modules/revsliderprestashop/public/revslider-front.class.php
813 /modules/revsliderprestashop/includes/backwards.php
814 /modules/revsliderprestashop/admin/includes/class-pclzip.php
815 /modules/revsliderprestashop/admin/includes/license.class.php
816 /modules/revsliderprestashop/admin/includes/addons.class.php
817 /modules/revsliderprestashop/admin/includes/template.class.php
818 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
819 /modules/revsliderprestashop/admin/includes/folder.class.php
820 /modules/revsliderprestashop/admin/includes/import.class.php
821 /modules/revsliderprestashop/admin/includes/export.class.php
822 /modules/revsliderprestashop/admin/includes/export-html.class.php
823 /modules/revsliderprestashop/admin/includes/newsletter.class.php
824 /modules/revsliderprestashop/admin/revslider-admin.class.php
825 /modules/revsliderprestashop/includes/update.class.php
826 /modules/revsliderprestashop/includes/resize-imag.php
827 /modules/revsliderprestashop/translations/it.php
828 /override/classes/Address.php
829 /classes/Address.php
830 /modules/arteinvoice/arteinvoice.php
831 /modules/arteinvoice/translations/it.php
832 /classes/ImageType.php
833 /classes/State.php
834 /src/Core/Security/PasswordPolicyConfiguration.php
835 /src/Core/Configuration/DataConfigurationInterface.php
836 /src/Core/Security/Hashing.php
837 /src/Core/Filter/FrontEndObject/MainFilter.php
838 /src/Core/Filter/FilterInterface.php
839 /src/Core/Filter/FrontEndObject/CartFilter.php
840 /src/Core/Filter/HashMapWhitelistFilter.php
841 /src/Core/Filter/CollectionFilter.php
842 /src/Core/Filter/FrontEndObject/ProductFilter.php
843 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
844 /src/Core/Filter/FrontEndObject/CustomerFilter.php
845 /src/Core/Filter/FrontEndObject/ShopFilter.php
846 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
847 /modules/lgcookieslaw/lgcookieslaw.php
848 /modules/lgcookieslaw/config/config.inc.php
849 /modules/lgcookieslaw/translations/it.php
850 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php
851 /vendor/defuse/php-encryption/src/Crypto.php
852 /vendor/defuse/php-encryption/src/KeyOrPassword.php
853 /vendor/defuse/php-encryption/src/RuntimeTests.php
854 /vendor/defuse/php-encryption/src/DerivedKeys.php
855 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
856 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
857 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
858 /var/cache/prod/smarty/compile/37/43/2c/37432c861bff16f5b2f4e73e17290a859706693a_2.file.view_cookies_scripts_content.tpl.php
859 /var/cache/prod/smarty/compile/19/c5/80/19c58092aad1b9d2c0faefe208b7555546f1a69f_2.file.view_header.tpl.php
860 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
861 /modules/ps_shoppingcart/ps_shoppingcart.php
862 /modules/productcomments/productcomments.php
863 /modules/iqitcompare/iqitcompare.php
864 /modules/iqitcompare/translations/it.php
865 /modules/iqitcontactpage/iqitcontactpage.php
866 /modules/iqitcontactpage/translations/it.php
867 /modules/iqitcountdown/iqitcountdown.php
868 /modules/iqitcountdown/translations/it.php
869 /modules/iqitelementor/iqitelementor.php
870 /modules/iqitelementor/src/IqitElementorLanding.php
871 /modules/iqitelementor/src/IqitElementorTemplate.php
872 /modules/iqitelementor/src/IqitElementorProduct.php
873 /modules/iqitelementor/src/IqitElementorCategory.php
874 /modules/iqitelementor/src/IqitElementorContent.php
875 /modules/iqitelementor/src/iqitElementorWpHelper.php
876 /modules/iqitelementor/includes/plugin-elementor.php
877 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
878 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
879 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
880 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
881 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
882 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
883 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
884 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
885 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
886 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
887 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
888 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
889 /modules/iqitelementor/translations/it.php
890 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
891 /modules/iqitfreedeliverycount/translations/it.php
892 /modules/iqitmegamenu/iqitmegamenu.php
893 /modules/iqitmegamenu/models/IqitMenuTab.php
894 /modules/iqitmegamenu/models/IqitMenuHtml.php
895 /modules/iqitmegamenu/models/IqitMenuLinks.php
896 /modules/iqitmegamenu/translations/it.php
897 /modules/iqitreviews/iqitreviews.php
898 /modules/iqitreviews/src/IqitProductReview.php
899 /modules/iqitwishlist/iqitwishlist.php
900 /modules/iqitwishlist/src/IqitWishlistProduct.php
901 /modules/iqitwishlist/translations/it.php
902 /modules/iqitextendedproduct/iqitextendedproduct.php
903 /modules/iqitextendedproduct/src/IqitThreeSixty.php
904 /modules/iqitextendedproduct/src/IqitProductVideo.php
905 /modules/iqitextendedproduct/translations/it.php
906 /modules/artproduttori/artproduttori.php
907 /modules/artproduttori/translations/it.php
908 /var/cache/prod/smarty/compile/shopwarehouse/2a/78/bf/2a78bfe324326a3e5b719fcedc43fa2217413e51_2.file.scriptV9.tpl.php
909 /modules/ganalyticspro/ganalyticspro.php
910 /modules/ganalyticspro/translations/it.php
911 /modules/ganalyticspro/lib/moduleTools.php
912 /modules/ganalyticspro/conf/moduleConfiguration.php
913 /modules/ganalyticspro/lib/hook/hookController.php
914 /modules/ganalyticspro/lib/hook/hookDisplay.php
915 /modules/ganalyticspro/lib/hook/hookInterface.php
916 /modules/ganalyticspro/lib/gtag/baseTag.php
917 /modules/ganalyticspro/lib/gtag/categoryTag.php
918 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
919 /classes/Combination.php
920 /classes/stock/StockAvailable.php
921 /classes/SpecificPrice.php
922 /classes/tax/TaxManagerFactory.php
923 /classes/tax/TaxRulesTaxManager.php
924 /classes/tax/TaxManagerInterface.php
925 /classes/tax/TaxCalculator.php
926 /classes/GroupReduction.php
927 /classes/Pack.php
928 /override/classes/Manufacturer.php
929 /classes/Manufacturer.php
930 /classes/Tag.php
931 /modules/ganalyticspro/models/orderRefund.php
932 /modules/ganalyticspro/models/orderPartialRefund.php
933 /var/cache/prod/smarty/compile/shopwarehouse/1c/84/58/1c8458cc9d4e9ed9c19ec87cbfcb12174e2707f9_2.file.header.tpl.php
934 /var/cache/prod/smarty/compile/shopwarehouse/b4/00/ef/b400eff9187b1d53d67faeda1e6035db24007b26_2.file.apichatgpt.tpl.php
935 /var/cache/prod/smarty/compile/shopwarehouse/67/1c/ce/671ccec8ce19597b0b74aa75c89c3e503b4f00be_2.file.head.tpl.php
936 /modules/shinystat/shinystat.php
937 /modules/shinystat/translations/it.php
938 /modules/ets_integrategooglemarketing/ets_integrategooglemarketing.php
939 /modules/ets_integrategooglemarketing/classes/Ets_integrategooglemarketing_defines.php
940 /modules/ets_integrategooglemarketing/translations/it.php
941 /var/cache/prod/smarty/compile/shopwarehouse/a5/b7/a4/a5b7a45ca285fcbfe2b88dceb9824ebefab6b6ac_2.file.google_tag_head.tpl.php
942 /var/cache/prod/smarty/compile/shopwarehouse/ce/33/81/ce33814f2d98ddedf15ce7084df0cb6273514cb7_2.file.google_search_console.tpl.php
943 /modules/cdc_googletagmanager/cdc_googletagmanager.php
944 /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php
945 /modules/cdc_googletagmanager/services/CdcTools.php
946 /modules/cdc_googletagmanager/services/PrestashopUtils.php
947 /modules/cdc_googletagmanager/classes/DataLayer.php
948 /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php
949 /modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php
950 /modules/cdc_googletagmanager/services/Gtm_Product.php
951 /modules/cdc_googletagmanager/classes/gtm/Refund.php
952 /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php
953 /modules/cdc_googletagmanager/classes/gtm_ga4/DataLayerItem.php
954 /modules/cdc_googletagmanager/translations/it.php
955 /modules/gremarketing/gremarketing.php
956 /modules/gremarketing/lib/moduleTools.php
957 /modules/gremarketing/translations/it.php
958 /modules/gremarketing/conf/moduleConfiguration.php
959 /modules/gremarketing/lib/hook/hookController.php
960 /modules/gremarketing/lib/hook/hookDisplay.php
961 /modules/gremarketing/lib/hook/hookBase.php
962 /modules/gmerchantcenterpro/gmerchantcenterpro.php
963 /modules/gmerchantcenterpro/translations/it.php
964 /modules/gmerchantcenterpro/lib/moduleTools.php
965 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
966 /modules/gmerchantcenterpro/lib/moduleUpdate.php
967 /modules/gmerchantcenterpro/lib/install/installController.php
968 /modules/gmerchantcenterpro/lib/install/installSql.php
969 /modules/gmerchantcenterpro/lib/install/installInterface.php
970 /modules/gmerchantcenterpro/models/Feeds.php
971 /modules/gremarketing/lib/tags/baseDynTag.php
972 /modules/gremarketing/lib/tags/dynamicCategoryTag.php
973 /var/cache/prod/smarty/compile/shopwarehouse/2f/9e/ea/2f9eea5170ce390e3df3ef367d69faf4aa1dac49_2.file.header.tpl.php
974 /modules/connettore/connettore.php
975 /modules/connettore/configurazione/configurazione_connettore.php
976 /modules/connettore/classes/AnubiLogger.php
977 /modules/connettore/classes/AnubiDbPDO.php
978 /modules/connettore/classes/DbWrapper.php
979 /modules/connettore/classes/BaseTask.php
980 /modules/connettore/classes/DbConnettore.php
981 /modules/connettore/classes/WebHelper.php
982 /modules/connettore/classes/Utils.php
983 /modules/connettore/classes/TestataOrdine.php
984 /modules/connettore/classes/RigaOrdine.php
985 /modules/connettore/tasks/TestTask.php
986 /modules/connettore/tasks/ImportazioneDatiTask.php
987 /modules/connettore/tasks/ImportazioneNuoveCategorieTask.php
988 /modules/connettore/tasks/AggiornamentoCategorieTask.php
989 /modules/connettore/tasks/ImportazioneNuoveFunzioniTask.php
990 /modules/connettore/tasks/ImportazioneNuoviProdottiTask.php
991 /modules/connettore/tasks/AggiornamentoProdottiTask.php
992 /modules/connettore/tasks/ImportazioneImmaginiProdottoTask.php
993 /modules/connettore/tasks/AttivazioneProdottiTask.php
994 /modules/connettore/tasks/AggiornamentoDisponibilitaTask.php
995 /modules/connettore/tasks/ImportazioneNuoviManufacturerTask.php
996 /modules/connettore/tasks/EliminaProdottiCheNonEsistonoTask.php
997 /modules/connettore/tasks/ImportazioneCorrelatiTask.php
998 /modules/connettore/tasks/AggiornamentoTagTask.php
999 /modules/connettore/tasks/AggiornamentoGiacenzeTask.php
1000 /modules/connettore/tasks/IndicizzazioneProdottiTask.php
1001 /modules/connettore/translations/it.php
1002 /modules/feedaty/feedaty.php
1003 /modules/feedaty/translations/it.php
1004 /modules/feedaty/it.php
1005 /modules/feedaty/lib/FeedatyClasses.php
1006 /modules/feedaty/lib/FeedatyWebservice.php
1007 /modules/feedaty/lib/FeedatyPositions.php
1008 /modules/feedaty/lib/FeedatyProtocols.php
1009 /modules/feedaty/lib/FeedatyGenerateElements.php
1010 /modules/feedaty/lib/FeedatyCsvController.php
1011 /modules/tec_dataminimizer/tec_dataminimizer.php
1012 /modules/ec_minorder/ec_minorder.php
1013 /modules/ec_minorder/translations/it.php
1014 /modules/multipleprices/multipleprices.php
1015 /modules/multipleprices/classes/MultiplepricesConfiguration.php
1016 /modules/multipleprices/translations/it.php
1017 /var/cache/prod/smarty/compile/shopwarehouse/1e/5b/1e/1e5b1ed75e7d2edf5948921999bdb0cfc282f073_2.file.styles.tpl.php
1018 /modules/payplug/payplug.php
1019 /modules/payplug/translations/it.php
1020 /modules/payplug/classes/PayPlugDependencies.php
1021 /modules/payplug/classes/DependenciesClass.php
1022 /modules/payplug/src/utilities/validators/accountValidator.php
1023 /modules/payplug/src/utilities/validators/browserValidator.php
1024 /modules/payplug/src/utilities/validators/cardValidator.php
1025 /modules/payplug/src/utilities/validators/lockValidator.php
1026 /modules/payplug/src/utilities/validators/loggerValidator.php
1027 /modules/payplug/src/utilities/validators/moduleValidator.php
1028 /modules/payplug/src/utilities/validators/orderValidator.php
1029 /modules/payplug/src/utilities/validators/paymentValidator.php
1030 /modules/payplug/src/utilities/helpers/AmountHelper.php
1031 /modules/payplug/src/utilities/helpers/ConfigurationHelper.php
1032 /modules/payplug/src/utilities/helpers/CookiesHelper.php
1033 /modules/payplug/src/utilities/helpers/FilesHelper.php
1034 /modules/payplug/src/utilities/helpers/PhoneHelper.php
1035 /modules/payplug/src/utilities/helpers/UserHelper.php
1036 /modules/payplug/src/application/dependencies/PluginInit.php
1037 /modules/payplug/src/application/dependencies/BaseClass.php
1038 /modules/payplug/src/actions/CardAction.php
1039 /modules/payplug/src/actions/CartAction.php
1040 /modules/payplug/src/actions/ConfigurationAction.php
1041 /modules/payplug/src/actions/MerchantTelemetryAction.php
1042 /modules/payplug/src/actions/OnboardingAction.php
1043 /modules/payplug/src/actions/OneyAction.php
1044 /modules/payplug/src/actions/OrderAction.php
1045 /modules/payplug/src/actions/RefundAction.php
1046 /modules/payplug/src/actions/OrderStateAction.php
1047 /modules/payplug/src/actions/PaymentAction.php
1048 /modules/payplug/src/models/entities/CacheEntity.php
1049 /modules/payplug/src/models/entities/OneyEntity.php
1050 /modules/payplug/src/models/entities/PluginEntity.php
1051 /modules/payplug/src/models/entities/OrderStateEntity.php
1052 /modules/payplug/src/application/adapter/AddressAdapter.php
1053 /modules/payplug/src/interfaces/AddressInterface.php
1054 /modules/payplug/src/application/adapter/AssignAdapter.php
1055 /modules/payplug/src/interfaces/AssignInterface.php
1056 /modules/payplug/src/application/adapter/CarrierAdapter.php
1057 /modules/payplug/src/interfaces/CarrierInterface.php
1058 /classes/Carrier.php
1059 /modules/payplug/src/application/adapter/CartAdapter.php
1060 /modules/payplug/src/interfaces/CartInterface.php
1061 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
1062 /modules/payplug/src/interfaces/ConfigurationInterface.php
1063 /modules/payplug/src/application/adapter/ConstantAdapter.php
1064 /modules/payplug/src/interfaces/ConstantInterface.php
1065 /modules/payplug/src/application/adapter/ContextAdapter.php
1066 /modules/payplug/src/interfaces/ContextInterface.php
1067 /modules/payplug/src/application/adapter/CountryAdapter.php
1068 /modules/payplug/src/interfaces/CountryInterface.php
1069 /modules/payplug/src/application/adapter/CurrencyAdapter.php
1070 /modules/payplug/src/interfaces/CurrencyInterface.php
1071 /modules/payplug/src/application/adapter/CustomerAdapter.php
1072 /modules/payplug/src/interfaces/CustomerInterface.php
1073 /modules/payplug/src/application/adapter/DispatcherAdapter.php
1074 /modules/payplug/src/interfaces/DispatcherInterface.php
1075 /modules/payplug/src/application/adapter/LanguageAdapter.php
1076 /modules/payplug/src/interfaces/LanguageInterface.php
1077 /modules/payplug/src/application/adapter/MediaAdapter.php
1078 /modules/payplug/src/interfaces/MediaInterface.php
1079 /modules/payplug/src/application/adapter/MessageAdapter.php
1080 /modules/payplug/src/interfaces/MessageInterface.php
1081 /modules/payplug/src/application/adapter/ModuleAdapter.php
1082 /modules/payplug/src/interfaces/ModuleInterface.php
1083 /modules/payplug/src/application/adapter/OrderAdapter.php
1084 /modules/payplug/src/interfaces/OrderInterface.php
1085 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
1086 /modules/payplug/src/interfaces/OrderHistoryInterface.php
1087 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
1088 /modules/payplug/src/interfaces/OrderSlipInterface.php
1089 /modules/payplug/src/application/adapter/OrderStateAdapter.php
1090 /modules/payplug/src/interfaces/OrderStateInterface.php
1091 /classes/order/OrderState.php
1092 /modules/payplug/src/application/adapter/ProductAdapter.php
1093 /modules/payplug/src/interfaces/ProductInterface.php
1094 /modules/payplug/src/application/adapter/QueryAdapter.php
1095 /modules/payplug/src/interfaces/QueryInterface.php
1096 /modules/payplug/src/application/adapter/ShopAdapter.php
1097 /modules/payplug/src/interfaces/ShopInterface.php
1098 /modules/payplug/src/application/adapter/TabAdapter.php
1099 /modules/payplug/src/interfaces/TabInterface.php
1100 /modules/payplug/src/application/adapter/ToolsAdapter.php
1101 /modules/payplug/src/interfaces/ToolsInterface.php
1102 /modules/payplug/src/application/adapter/TranslationAdapter.php
1103 /modules/payplug/src/interfaces/TranslationInterface.php
1104 /modules/payplug/src/application/adapter/ValidateAdapter.php
1105 /modules/payplug/src/interfaces/ValidateInterface.php
1106 /modules/payplug/src/models/classes/Address.php
1107 /modules/payplug/src/models/classes/ApiRest.php
1108 /modules/payplug/src/models/classes/Configuration.php
1109 /modules/payplug/src/models/classes/Country.php
1110 /modules/payplug/src/models/classes/Order.php
1111 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
1112 /modules/payplug/src/models/classes/Translation.php
1113 /modules/payplug/src/models/repositories/CardRepository.php
1114 /modules/payplug/src/models/repositories/QueryRepository.php
1115 /modules/payplug/src/models/repositories/CacheRepository.php
1116 /modules/payplug/src/models/repositories/CountryRepository.php
1117 /modules/payplug/src/models/repositories/LockRepository.php
1118 /modules/payplug/src/models/repositories/LoggerRepository.php
1119 /modules/payplug/src/models/repositories/ModuleRepository.php
1120 /modules/payplug/src/models/repositories/OrderRepository.php
1121 /modules/payplug/src/models/repositories/OrderStateRepository.php
1122 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
1123 /modules/payplug/src/models/repositories/PaymentRepository.php
1124 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
1125 /modules/payplug/src/models/repositories/ShopRepository.php
1126 /modules/payplug/classes/MyLogPHP.php
1127 /modules/payplug/src/repositories/LoggerRepository.php
1128 /modules/payplug/src/models/entities/LoggerEntity.php
1129 /modules/payplug/src/repositories/TranslationsRepository.php
1130 /modules/payplug/src/repositories/SQLtableRepository.php
1131 /modules/payplug/src/repositories/CacheRepository.php
1132 /modules/payplug/src/repositories/OrderStateRepository.php
1133 /modules/payplug/src/repositories/InstallRepository.php
1134 /modules/payplug/src/utilities/services/API.php
1135 /modules/payplug/src/utilities/services/Browser.php
1136 /modules/payplug/src/utilities/services/Routes.php
1137 /modules/payplug/src/utilities/services/MerchantTelemetry.php
1138 /modules/payplug/classes/ApiClass.php
1139 /modules/payplug/classes/ApplePayClass.php
1140 /modules/payplug/classes/AmountCurrencyClass.php
1141 /modules/payplug/classes/AdminClass.php
1142 /modules/payplug/classes/PayplugLock.php
1143 /modules/payplug/classes/CartClass.php
1144 /modules/payplug/classes/ConfigClass.php
1145 /modules/payplug/classes/InstallmentClass.php
1146 /modules/payplug/classes/HookClass.php
1147 /modules/payplug/classes/MediaClass.php
1148 /modules/payplug/classes/OrderClass.php
1149 /modules/payplug/classes/PaymentClass.php
1150 /modules/payplug/classes/RefundClass.php
1151 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1152 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1153 /modules/sendinblue/sendinblue.php
1154 /modules/sendinblue/translations/it.php
1155 /modules/sendinblue/services/ConfigService.php
1156 /modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php
1157 /modules/absfrequentlyboughttogether/class/AbsBuyItWith.php
1158 /modules/absfrequentlyboughttogether/class/AbsPromoFqb.php
1159 /modules/absfrequentlyboughttogether/translations/it.php
1160 /modules/trustedprogramintegration/trustedprogramintegration.php
1161 /modules/trustedprogramintegration/translations/it.php
1162 /src/Core/Product/Search/ProductSearchContext.php
1163 /src/Core/Product/Search/ProductSearchQuery.php
1164 /src/Core/Product/Search/SortOrder.php
1165 /modules/ps_facetedsearch/ps_facetedsearch.php
1166 /modules/ps_facetedsearch/src/HookDispatcher.php
1167 /modules/ps_facetedsearch/src/Hook/Attribute.php
1168 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1169 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1170 /modules/ps_facetedsearch/src/Hook/Category.php
1171 /modules/ps_facetedsearch/src/Hook/Configuration.php
1172 /modules/ps_facetedsearch/src/Hook/Design.php
1173 /modules/ps_facetedsearch/src/Hook/Feature.php
1174 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1175 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1176 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1177 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1178 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1179 /modules/ps_facetedsearch/src/Hook/Product.php
1180 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1181 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1182 /modules/ps_facetedsearch/src/Filters/Provider.php
1183 /modules/ps_facetedsearch/src/URLSerializer.php
1184 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1185 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1186 /src/Core/Product/Search/FacetsRendererInterface.php
1187 /src/Core/Product/Search/ProductSearchProviderInterface.php
1188 /modules/ps_facetedsearch/src/Filters/Converter.php
1189 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1190 /src/Core/Product/Search/ProductSearchResult.php
1191 /modules/ps_facetedsearch/src/Product/Search.php
1192 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1193 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1194 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1195 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1196 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1197 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1198 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1199 /modules/ps_facetedsearch/src/Filters/Products.php
1200 /modules/ps_facetedsearch/src/Filters/Block.php
1201 /modules/ps_facetedsearch/src/Definition/Availability.php
1202 /src/Core/Util/String/StringModifier.php
1203 /src/Core/Util/String/StringModifierInterface.php
1204 /src/Core/Product/Search/Facet.php
1205 /src/Core/Product/Search/Filter.php
1206 /src/Core/Product/Search/FacetCollection.php
1207 /classes/ProductAssembler.php
1208 /classes/ProductPresenterFactory.php
1209 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1210 /src/Adapter/Presenter/Product/ProductPresenter.php
1211 /src/Adapter/Product/ProductColorsRetriever.php
1212 /src/Core/Product/ProductPresentationSettings.php
1213 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1214 /src/Adapter/Presenter/Product/ProductLazyArray.php
1215 /src/Adapter/Presenter/AbstractLazyArray.php
1216 /classes/Image.php
1217 /src/Core/Image/ImageFormatConfiguration.php
1218 /src/Core/Image/ImageFormatConfigurationInterface.php
1219 /classes/FeatureFlag.php
1220 /src/Core/FeatureFlag/FeatureFlagSettings.php
1221 /src/Core/Util/Inflector.php
1222 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1223 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1224 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1225 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1226 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1227 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1228 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1229 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1230 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1231 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1232 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1233 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1234 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1235 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1236 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1237 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1238 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1239 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1240 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1241 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1242 /var/cache/prod/smarty/compile/shopwarehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1243 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1244 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1245 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1246 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1247 /var/cache/prod/smarty/compile/shopwarehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1248 /src/Core/Product/Search/Pagination.php
1249 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f8/11/cb/f811cb95a71b2aadd97e674a0f709876f06d4c42_2.file.category.tpl.php
1250 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1251 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/b2/a5/fe/b2a5fee663562893eda7670099e89eec5d81a1fb_2.file.product-list.tpl.php
1252 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/dd/fe/b9/ddfeb954e222c722253739f7845703c29eaea402_2.file.layout-left-column.tpl.php
1253 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5a/ce/e5/5acee588265771a51ffc84701e00bdd02c9abdf2_2.file.layout-both-columns.tpl.php
1254 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c5/08/43/c508439c1a96a30f9de64446737e6ee1927dfb3b_2.file.helpers.tpl.php
1255 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1256 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/6f/91/236f91d2776e44271e012c43db1c691696c15040_2.file.head.tpl.php
1257 /vendor/smarty/smarty/libs/sysplugins/smarty_undefined_variable.php
1258 /var/cache/prod/smarty/compile/shopwarehouse/27/e9/b0/27e9b031b55351a9f084c5addac17fcde073133e_2.file.gtm_tag.tpl.php
1259 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/fb/db/48/fbdb48daf1e14bbe07fd3699d645f11debb2eb1a_2.file.head-jsonld.tpl.php
1260 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/16/ce/59/16ce59339f787d6cb8ac4f7c0a7f20e99de1b839_2.file.product-list-jsonld.tpl.php
1261 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/0a/0b/4c/0a0b4c89241f913d59419ea9a3612aa6515190d1_2.file.pagination-seo.tpl.php
1262 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1263 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/b9/7c/beb97cb450a9f69fd43c061d99fbdfad7181c6f6_2.file.stylesheets.tpl.php
1264 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ae/4d/30/ae4d30f43146c6e1ffaee0607d30f548b596517f_2.file.javascript.tpl.php
1265 /var/cache/prod/smarty/compile/shopwarehouse/46/35/48/463548647f97f9e2cce954b7188c1f350dab323f_2.file.google_tag_body.tpl.php
1266 /var/cache/prod/smarty/compile/shopwarehouse/5d/db/c8/5ddbc86a06a0a0d6e76e4f9fba4952f2f24c5192_2.file.gtm_tag_noscript.tpl.php
1267 /var/cache/prod/smarty/compile/27/a8/a7/27a8a764939f2f3d8f7490893049eba541e593c2_2.file.view_after_body_opening_tag_header.tpl.php
1268 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/98/20/ef/9820ef0925d3fee40988d8cee22dbe868c6cb068_2.file.product-activation.tpl.php
1269 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/8c/bc/41/8cbc41da8acb85d754b2c50cfefb91ed607a9edf_2.file.header.tpl.php
1270 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e9/b9/d5/e9b9d508f2dd480341846be452ac6f6672284f34_2.file.social-links.tpl.php
1271 /modules/iqitlinksmanager/iqitlinksmanager.php
1272 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1273 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1274 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1275 /modules/iqitlinksmanager/translations/it.php
1276 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1277 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1278 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1279 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayNav1/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1280 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1281 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1282 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1283 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1284 /modules/iqithtmlandbanners/translations/it.php
1285 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayNavCenter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1286 /modules/ps_languageselector/ps_languageselector.php
1287 /modules/ps_currencyselector/ps_currencyselector.php
1288 /var/cache/prod/smarty/compile/shopwarehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1289 /var/cache/prod/smarty/compile/shopwarehouse/a7/b4/2a/a7b42a5e4e0a5166bfca3e9be0e40e49bcdd454f_2.module.iqitcompareviewstemplateshookdisplaynav.tpl.php
1290 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/9a/e8/a0/9ae8a0bf6f8a38863b91cfc212bb6ceb2292b8a7_2.file.header-1.tpl.php
1291 /modules/iqitsearch/iqitsearch.php
1292 /modules/iqitsearch/translations/it.php
1293 /var/cache/prod/smarty/compile/shopwarehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1294 /var/cache/prod/smarty/compile/shopwarehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1295 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/5e/3f/235e3f5ee59d64225af247fb2228e65cd3fe7fb0_2.module.ps_shoppingcartps_shoppingcartdefault.tpl.php
1296 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1297 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1298 /modules/ps_customersignin/ps_customersignin.php
1299 /var/cache/prod/smarty/compile/shopwarehouse/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1300 /modules/pagesnotfound/pagesnotfound.php
1301 /var/cache/prod/smarty/compile/shopwarehouse/63/ba/59/63ba5972c9730522e9fb200398edbc11f4f58089_2.file.feedaty-widget-store.tpl.php
1302 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/10/shopwarehouse/a8/34/6d/a8346d2dc5b79e1534b3385fa0faac4b475b9eb4.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1303 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/1c/e5/92/1ce5928ab8218bc3ddcd60c352dd1d71893f7908_2.file.mobile-header-3.tpl.php
1304 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1305 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1306 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1307 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/62/43/78/624378c7dfeb412830a19d0b0b37a8715548f5cf_2.file.breadcrumb.tpl.php
1308 /modules/iqitproductsnav/iqitproductsnav.php
1309 /modules/iqitproductsnav/translations/it.php
1310 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5e/e2/b8/5ee2b817b44046586c6272340d6af59d1a367ad4_2.file.notifications.tpl.php
1311 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/89/a9/18/89a918329b56f1c800efdd755b39ba9f219ec921_2.file.category-header.tpl.php
1312 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ef/6d/4c/ef6d4c7a880f80029c6b448812468d37383ff042_2.file.category-subcategories.tpl.php
1313 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/26/2c/5e/262c5ee15c17f10153d38421d802f53b3a380c71_2.file.products-top.tpl.php
1314 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1315 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c9/f1/91/c9f191209eb3f477d74071d448cc161f10778b3c_2.file.sort-orders.tpl.php
1316 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c1/47/e9/c147e97b1ab26489e3f10827386d1bcd455d4114_2.file.products.tpl.php
1317 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/b9/de/a6b9dee9c985ceb3eeded4c44440dc98077b6366_2.file.product-list.tpl.php
1318 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/82/b8/3a/82b83aed6eab9dedf4c24a9d0b1f481ebb09cd2c_2.file.product-miniature-thumb.tpl.php
1319 /var/cache/prod/smarty/compile/shopwarehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1320 /vendor/smarty/smarty/libs/plugins/function.math.php
1321 /var/cache/prod/smarty/compile/shopwarehouse/54/50/60/54506057f821234b35c479582bc2dc0b2fc98e35_2.file.artlistproduttori-ps17.tpl.php
1322 /vendor/smarty/smarty/libs/plugins/modifier.date_format.php
1323 /classes/ProductSupplier.php
1324 /var/cache/prod/smarty/compile/shopwarehouse/a9/94/a3/a994a3c5a500481515bc7b0596a4818bfcc60e9d_2.file.text.tpl.php
1325 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e5/37/94/e5379437e7cb07eac35c6b76d06b8bbdd09277e9_2.file.product-miniature-btn.tpl.php
1326 /var/cache/prod/smarty/compile/shopwarehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1327 /var/cache/prod/smarty/compile/shopwarehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
1328 /vendor/prestashop/decimal/src/Operation/Addition.php
1329 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/4d/f5/a64df5b4b109264f55bc8c441b2ddd649e00fe0b_2.file.pagination.tpl.php
1330 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7d/c7/b9/7dc7b920724d67c85c9a1148ffc6e1352c81c741_2.file.products-bottom.tpl.php
1331 /var/cache/prod/smarty/cache/ybc_blog/7928/1/1/1/10/240508/shopwarehouse/ce/42/62/ce4262669d57a99fd312a58083a030ff04f2f417.related_posts_category.tpl.php
1332 /modules/ps_categorytree/ps_categorytree.php
1333 /var/cache/prod/smarty/compile/shopwarehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1334 /var/cache/prod/smarty/compile/shopwarehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1335 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/31/e3/1e/31e31e2f9e0e15e082e36c94e3ce506f8b52318b_2.file.footer.tpl.php
1336 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/59/d8/c5/59d8c5b4bd8f7dc7e77b4b784cf989309f96e9a6_2.file.footer-2.tpl.php
1337 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayFooter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1338 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayFooter/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1339 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/10/shopwarehouse/31/45/63/3145630ee48f34c64dce20915cd36a7d798fa52b.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1340 /var/cache/prod/smarty/compile/shopwarehouse/59/fa/4a/59fa4a468746e7397894d4d55728b7a0399415fc_2.file.artinvoice_js.tpl.php
1341 /var/cache/prod/smarty/compile/shopwarehouse/c8/59/18/c85918ff6d9da0aabb89af560f45f255349ce95e_2.file.footer.tpl.php
1342 /modules/lgcookieslaw/classes/LGCookiesLawCookie.php
1343 /classes/CMS.php
1344 /var/cache/prod/smarty/compile/b1/74/ee/b174ee22d35566f04bb92c3cdb14885c864f06e9_2.file.view_banner.tpl.php
1345 /var/cache/prod/smarty/compile/shopwarehouse/76/b6/77/76b677d100d34eed3ff7a027ae76cd2d2caafd5f_2.file.shinystat.tpl.php
1346 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f3/e2/01/f3e201110b395deed6ef05594261db3284242b23_2.file.footer-copyrights-1.tpl.php
1347 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d2/ed/33/d2ed337060b8ed3aaacc807eb44ca9f06bc7740c_2.file.password-policy-template.tpl.php
1348 /classes/form/CustomerLoginForm.php
1349 /classes/form/AbstractForm.php
1350 /classes/form/FormInterface.php
1351 /src/Core/Foundation/Templating/RenderableInterface.php
1352 /classes/form/CustomerLoginFormatter.php
1353 /classes/form/FormFormatterInterface.php
1354 /classes/ValidateConstraintTranslator.php
1355 /src/Core/Util/InternationalizedDomainNameConverter.php
1356 /src/Core/Foundation/Templating/RenderableProxy.php
1357 /var/cache/prod/smarty/compile/shopwarehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1358 /classes/form/FormField.php
1359 /var/cache/prod/smarty/compile/shopwarehouse/22/1c/83/221c831891cf43068d82e5d2cedfd7083701554e_2.file.login-form.tpl.php
1360 /var/cache/prod/smarty/compile/shopwarehouse/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1361 /var/cache/prod/smarty/compile/8f/74/7a/8f747aa7caf4a60dae1415d8fc15828b2e6a2977_2.file.form-fields.tpl.php
1362 /var/cache/prod/smarty/compile/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1363 /var/cache/prod/smarty/compile/shopwarehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1364 /modules/statsdata/statsdata.php
1365 /classes/Guest.php
1366 /classes/Connection.php
1367 /classes/Page.php
1368 /classes/ConnectionsSource.php