strumenti disegno

Strumenti disegno: penne disegno tecnico, compassi - balaustroni, squadre, righe - righelli, goniometri - curvilinee, parallelografi - tecnigrafi, maschere - normografi, scalimetri, inchiostro china, tubi portadisegni - bande appendidisegni, kit stationary

prodotto aggiunto alla lista
Prodotto aggiunto per il confronto.
Load Time 1814 ms
Querying Time 1368 ms
Queries 1352
Memory Peak Usage 34.4 Mb
Included Files 1410 files - 18.07 Mb
PrestaShop Cache - Mb
Global vars 1.39 Mb
PrestaShop Version 8.1.5
PHP Version 8.1.28
MySQL Version 10.1.48-MariaDB-0ubuntu0.18.04.1
Memory Limit 1024M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 12.042 ms 12.042 ms 3.85 Mb 3.9 Mb
__construct 0.012 ms 12.054 ms - Mb 3.9 Mb
init 14.276 ms 26.330 ms 0.79 Mb 4.9 Mb
checkAccess 0.002 ms 26.332 ms - Mb 4.9 Mb
setMedia 6.605 ms 32.937 ms 0.17 Mb 5.0 Mb
postProcess 0.003 ms 32.940 ms - Mb 5.0 Mb
initHeader 0.000 ms 32.940 ms - Mb 5.0 Mb
initContent 1508 ms 1541 ms 13.27 Mb 21.0 Mb
initFooter 0.003 ms 1541 ms - Mb 21.0 Mb
display 273.256 ms 1814 ms 15.03 Mb 34.4 Mb
Hook Time Memory Usage
DisplayHeader 234.493 ms 7.30 Mb
DisplayProductPriceBlock 107.161 ms 8.40 Mb
DisplayAfterTitleTag 50.468 ms 2.72 Mb
displayProductListReviews 17.581 ms 0.55 Mb
displayProductListFunctionalButtons 8.630 ms 0.03 Mb
Header 7.933 ms 0.08 Mb
DisplayProductListReviews 5.438 ms - Mb
DisplayTop 5.233 ms 0.15 Mb
DisplayBeforeBodyClosingTag 5.187 ms 0.17 Mb
ActionFrontControllerSetMedia 5.050 ms 0.12 Mb
renderWidget 4.821 ms 0.16 Mb
DisplayFooterCategory 4.630 ms 0.11 Mb
DisplayFooter 4.091 ms 0.28 Mb
displayNav2 2.816 ms 0.17 Mb
displayLeftColumn 2.496 ms 0.06 Mb
displayNav1 1.435 ms 0.09 Mb
displayFooter 1.427 ms 0.09 Mb
displayBeforeBodyClosingTag 1.265 ms 0.07 Mb
displayNavCenter 1.159 ms 0.05 Mb
displayMainMenu 0.970 ms 0.46 Mb
displayCategoryElementor 0.804 ms 0.08 Mb
DisplayAfterBodyOpeningTag 0.576 ms 0.03 Mb
displayAfterBreadcrumb 0.443 ms 0.04 Mb
IsJustElementor 0.323 ms 0.02 Mb
ActionDispatcherBefore 0.288 ms 0.01 Mb
ProductSearchProvider 0.283 ms 0.01 Mb
DisplayLeftColumn 0.267 ms 0.06 Mb
DisplayFooterAfter 0.147 ms 0.01 Mb
ModuleRoutes 0.104 ms 0.03 Mb
OverrideLayoutTemplate 0.053 ms - Mb
displayVerticalMenu 0.012 ms - Mb
ActionFrontControllerInitAfter 0.010 ms - Mb
ActionProductSearchAfter 0.009 ms - Mb
ActionDispatcher 0.008 ms - Mb
DisplayFooterBefore 0.007 ms - Mb
35 hook(s) 475.617 ms 21.25 Mb
Module Time Memory Usage
doofinder 3.086 ms - Mb
ybc_blog 12.740 ms 0.59 Mb
simpleimportproduct 5.249 ms 0.35 Mb
ets_abandonedcart 2.107 ms 0.17 Mb
ps_mbo 2.349 ms 0.11 Mb
iqitthemeeditor 1.035 ms 0.26 Mb
ps_emailsubscription 0.339 ms 0.01 Mb
ps_emailalerts 0.206 ms 0.01 Mb
ps_checkout 5.094 ms - Mb
ps_accounts 0.278 ms - Mb
psrecaptcha 0.373 ms 0.17 Mb
revsliderprestashop 1.019 ms 0.03 Mb
arteinvoice 0.406 ms 0.02 Mb
lgcookieslaw 6.365 ms 0.37 Mb
ps_shoppingcart 0.134 ms 0.01 Mb
productcomments 0.154 ms 0.01 Mb
iqitcompare 5.694 ms 0.03 Mb
iqitcontactpage 0.956 ms 0.06 Mb
iqitcountdown 0.269 ms 0.01 Mb
iqitelementor 1.568 ms 0.11 Mb
iqitfreedeliverycount 0.173 ms 0.01 Mb
iqitmegamenu 2.385 ms 0.47 Mb
iqitreviews 17.782 ms 0.56 Mb
iqitwishlist 6.634 ms 0.15 Mb
iqitextendedproduct 0.230 ms 0.01 Mb
artproduttori 5.597 ms - Mb
ganalyticspro 204.154 ms 6.30 Mb
shinystat 0.600 ms 0.01 Mb
ets_integrategooglemarketing 0.870 ms 0.03 Mb
cdc_googletagmanager 51.419 ms 2.81 Mb
gremarketing 19.332 ms 0.54 Mb
gmerchantcenterpro 12.469 ms 0.38 Mb
connettore 0.894 ms 0.05 Mb
feedaty 7.221 ms 0.17 Mb
tec_dataminimizer 0.210 ms 0.01 Mb
ec_minorder 0.556 ms 0.01 Mb
multipleprices 88.673 ms 6.95 Mb
payplug 53.597 ms 1.76 Mb
sendinblue 0.552 ms 0.01 Mb
absfrequentlyboughttogether 0.270 ms 0.01 Mb
trustedprogramintegration 0.202 ms 0.01 Mb
ps_facetedsearch 0.793 ms 0.09 Mb
iqitlinksmanager 2.159 ms 0.12 Mb
iqithtmlandbanners 2.088 ms 0.07 Mb
ps_languageselector 0.893 ms 0.05 Mb
ps_currencyselector 0.526 ms 0.05 Mb
iqitsearch 2.843 ms 0.10 Mb
ps_customersignin 2.559 ms 0.05 Mb
pagesnotfound 0.134 ms 0.01 Mb
iqitproductsnav 0.904 ms 0.04 Mb
ps_categorytree 2.666 ms 0.08 Mb
statsdata 5.040 ms 0.17 Mb
52 module(s) 543.848 ms 23.22 Mb

Stopwatch SQL - 1352 queries

# Query Time (ms) Rows Filesort Group By Location
590
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 295 ORDER BY vl.`value` ASC
51.861 ms 3112 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
578
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
48.731 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
1009
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 68429
ORDER BY `position`
30.986 ms 4 Yes /classes/Product.php:3545
576
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 281 ORDER BY vl.`value` ASC
24.098 ms 561 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
559
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
20.690 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
683
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=394)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
19.816 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
821
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=535)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
17.345 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
563
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071)))
15.432 ms 450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
843
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=561)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
14.115 ms 420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
574
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 280 ORDER BY vl.`value` ASC
12.727 ms 507 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
710
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=422)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
12.145 ms 900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
712
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=424)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
11.732 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
874
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33192 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33192 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
11.686 ms 0 /classes/Cart.php:1423
786
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=499)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
10.787 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
737
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=450)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
10.592 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
570
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `uag_manufacturer` m INNER JOIN uag_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `uag_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
10.375 ms 738 Yes /classes/Manufacturer.php:211
687
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=398)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
10.201 ms 480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
715
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=427)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
9.667 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1119
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33115) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
9.457 ms 1 Yes Yes /classes/Product.php:4520
674
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=385)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
9.058 ms 300 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
577
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=282)) GROUP BY fp.id_feature_value
8.461 ms 236482884 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1117
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1
8.141 ms 1 /classes/module/Module.php:2109
974
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33181
ORDER BY `position`
8.121 ms 1 Yes /classes/Product.php:3545
920
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 49114 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 49114 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
8.029 ms 0 /classes/Cart.php:1423
690
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=401)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
7.945 ms 900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1041
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33197) LIMIT 1
7.524 ms 1 /src/Adapter/EntityMapper.php:71
678
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=389)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
7.284 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
743
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=456)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
6.695 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
98
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
6.389 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:109
595
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=300)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
6.288 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
791
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=504)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
6.280 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
811
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=524)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.997 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
573
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=280)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.992 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
820
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=534)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.894 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
735
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=448)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.870 ms 960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
575
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=281)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.775 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
716
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=428)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.666 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
643
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=351)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.412 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
740
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=453)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
5.278 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
558
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `uag_feature` f  INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `uag_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
5.246 ms 280 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
967
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33115
ORDER BY `position`
5.111 ms 1 Yes /classes/Product.php:3545
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `uag_configuration` c
LEFT JOIN `uag_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
5.060 ms 2111 /classes/Configuration.php:180
571
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) GROUP BY p.id_manufacturer
5.057 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
864
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33184
ORDER BY f.position ASC
5.024 ms 3 Yes /classes/Product.php:6015
742
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=455)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.998 ms 540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
778
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=491)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.981 ms 840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
750
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=463)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.812 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
840
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=554)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.544 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
579
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=283)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.508 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
741
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=454)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.423 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1130
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration_lang`
WHERE `id_multipleprices_configuration` = 1
4.355 ms 1 /src/Adapter/EntityMapper.php:79
679
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=390)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.197 ms 780 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
708
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=420)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.166 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
686
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=397)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
4.156 ms 480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
991
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 43414
ORDER BY `position`
4.140 ms 1 Yes /classes/Product.php:3545
87
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `uag_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `uag_hook_alias` ha
INNER JOIN `uag_hook` h ON ha.name = h.name
4.131 ms 0 /classes/Hook.php:1292
705
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=417)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.999 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
842
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=560)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.948 ms 900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
711
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=423)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.891 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
147
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33112 LIMIT 1
3.883 ms 1 /classes/SpecificPrice.php:435
707
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=419)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.757 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
565
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
3.753 ms 718 Yes /classes/Category.php:724
698
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=410)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.708 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
810
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=523)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.671 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
736
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=449)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.606 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
88
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `uag_hook_module` hm
STRAIGHT_JOIN `uag_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `uag_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
3.528 ms 666 /classes/Hook.php:456
734
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=447)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.357 ms 660 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
925
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 49118)
3.343 ms 1 /classes/Product.php:3860
1044
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33197 LIMIT 1
3.334 ms 1 /classes/Product.php:1106
700
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=412)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.324 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
388
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33114
3.322 ms 1 /classes/Tag.php:244
554
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "payplug" LIMIT 1
3.316 ms 1 /classes/module/Module.php:2636
957
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 49115
ORDER BY f.position ASC
3.295 ms 4 Yes /classes/Product.php:6015
841
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=555)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.204 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
691
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=402)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.200 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `uag_module` m
INNER JOIN uag_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `uag_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `uag_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `uag_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.185 ms 202 Yes Yes /classes/Hook.php:1233
844
REPLACE INTO uag_layered_filter_block (hash, data) VALUES ("a9ec9edfd2cc3ac915416754dd807397", "a:1:{s:7:\"filters\";a:8:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:9:\"Categorie\";s:6:\"values\";a:3:{i:8218;a:2:{s:4:\"name\";s:22:\"compassi - balaustroni\";s:3:\"nbr\";i:11;}i:8234;a:2:{s:4:\"name\";s:7:\"squadre\";s:3:\"nbr\";i:1;}i:8235;a:2:{s:4:\"name\";s:16:\"righe - righelli\";s:3:\"nbr\";i:3;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilità\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:12:\"In magazzino\";s:3:\"nbr\";i:13;}i:0;a:2:{s:4:\"name\";s:15:\"Non disponibile\";s:3:\"nbr\";i:2;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:5:{i:28518;a:2:{s:4:\"name\";s:4:\"Arda\";s:3:\"nbr\";i:4;}i:28722;a:2:{s:4:\"name\";s:5:\"Maped\";s:3:\"nbr\";i:1;}i:32293;a:2:{s:4:\"name\";s:9:\"Staedtler\";s:3:\"nbr\";i:1;}i:69192;a:2:{s:4:\"name\";s:13:\"Faber-Castell\";s:3:\"nbr\";i:8;}i:69301;a:2:{s:4:\"name\";s:10:\"Koh.I.Noor\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:3;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Prezzo\";s:3:\"max\";d:26;s:3:\"min\";d:1;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:15;s:5:\"value\";N;}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:280;s:6:\"values\";a:3:{i:522;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:16:\"Grigio alluminio\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:244;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"Silver\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:22;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:11:\"Trasparente\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Colore\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:281;s:6:\"values\";a:4:{i:1083;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:9:\"Alluminio\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:176;a:4:{s:3:\"nbr\";i:8;s:4:\"name\";s:7:\"Metallo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:60;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:6:\"Ottone\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:27;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:8:\"Plastica\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Materiale\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:6;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:282;s:6:\"values\";a:16:{i:61;a:5:{s:3:\"nbr\";i:11;s:4:\"name\";s:11:\"Balaustrone\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1416;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:20:\"Bande appendidisegno\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1838;a:4:{s:3:\"nbr\";i:17;s:4:\"name\";s:8:\"Compassi\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1075;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"Curvilinee\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1071;a:5:{s:3:\"nbr\";i:4;s:4:\"name\";s:15:\"Doppiodecimetri\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1073;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:10:\"Goniometri\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1180;a:4:{s:3:\"nbr\";i:12;s:4:\"name\";s:19:\"Inchiostro di china\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1080;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:8:\"Maschere\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2797;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:17:\"Mine per compasso\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1114;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:10:\"Normografi\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1077;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:14:\"Parallelografi\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1070;a:4:{s:3:\"nbr\";i:23;s:4:\"name\";s:8:\"Righelli\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1113;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:10:\"Scalimetri\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1065;a:4:{s:3:\"nbr\";i:22;s:4:\"name\";s:7:\"Squadre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1072;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:15:\"Triplodecimetri\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1048;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:9:\"Valigette\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Tipologia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:7;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:295;s:6:\"values\";a:8:{i:2331;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Ø 17cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1914;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:7:\"Ø 30cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:62;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"Ø 33-58cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:7314;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Ø 34cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2748;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Ø 35cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:3450;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:7:\"Ø 39cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:7315;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Ø 45cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2804;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Ø 57cm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:10:\"Dimensione\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}}}")
3.133 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
732
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=445)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.128 ms 720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
818
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=532)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.045 ms 840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
752
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=465)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.041 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
792
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=505)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
3.027 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
530
BEGIN
3.002 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:74
566
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND cg.id_group='1' AND c.level_depth<=5 AND c.nleft>447 AND c.nright<470 GROUP BY cp.id_category
2.980 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
819
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=533)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.965 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
772
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=485)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.961 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
697
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=409)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.960 ms 900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
817
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=530)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.960 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
137
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
2.958 ms 1 /classes/Product.php:5655
714
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=426)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.945 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
813
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=526)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.930 ms 360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
634
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=342)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.894 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
569
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (61, 1071)))
2.887 ms 450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
667
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=377)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.881 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
603
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=308)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.877 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
555
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 130 AND `id_shop` = 1 LIMIT 1
2.863 ms 1 /classes/module/Module.php:2109
568
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (61, 1071)))
2.845 ms 450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
676
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=387)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.833 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1333
SELECT SQL_NO_CACHE p.*,pc.id_category, pl.image,pl.thumb, pl.title, pl.description, pl.short_description, pl.meta_keywords, pl.meta_description,pl.url_alias,e.firstname, e.lastname,pc.position,count(pcm.id_comment) as total_comment,IFNULL(ybe.status,1) as status
FROM `uag_ybc_blog_post` p
INNER JOIN `uag_ybc_blog_post_shop` ps ON (p.id_post=ps.id_post AND ps.id_shop='1')
LEFT JOIN `uag_ybc_blog_post_lang` pl ON p.id_post = pl.id_post AND pl.id_lang = 1
LEFT JOIN `uag_ybc_blog_post_category` pc ON (p.id_post = pc.id_post ) 
LEFT JOIN `uag_ybc_blog_post_related_categories` rpc ON (p.id_post = rpc.id_post)
LEFT JOIN `uag_customer` c ON (c.id_customer=p.added_by AND p.is_customer=1)
LEFT JOIN `uag_employee` e ON (e.id_employee=p.added_by AND p.is_customer=0)
LEFT JOIN `uag_ybc_blog_employee` ybe ON ((ybe.id_employee=c.id_customer AND ybe.is_customer=1) OR (ybe.id_employee=e.id_employee AND ybe.is_customer=0))
LEFT JOIN `uag_ybc_blog_comment` pcm on (pcm.id_post=p.id_post)
WHERE 1  AND p.enabled=1 AND rpc.id_category=7902  
GROUP BY p.id_post
ORDER BY p.datetime_added DESC,  p.id_post DESC  LIMIT 0, 6
2.787 ms 1 Yes /modules/ybc_blog/classes/ybc_blog_post_class.php:262
921
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 49114
ORDER BY f.position ASC
2.768 ms 3 Yes /classes/Product.php:6015
771
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=484)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.731 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
552
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7902 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
2.697 ms 199 /classes/Category.php:1062
774
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=487)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.648 ms 540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
669
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=379)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.641 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
906
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 43414 LIMIT 1
2.602 ms 1 /classes/SpecificPrice.php:435
837
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=551)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.585 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
730
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=443)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.567 ms 600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
830
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=544)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.545 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
704
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=416)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.502 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
680
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=391)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.490 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
589
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=295)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.481 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
682
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=393)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.476 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
623
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=330)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.468 ms 720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
562
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC LIMIT 0, 24
2.454 ms 225 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
812
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=525)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.443 ms 660 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
833
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=547)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.442 ms 780 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
702
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=414)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.431 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
773
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=486)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.418 ms 840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
875
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33192
ORDER BY f.position ASC
2.408 ms 3 Yes /classes/Product.php:6015
815
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=528)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.392 ms 300 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
557
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM uag_layered_category
WHERE controller = 'category'
AND id_category = 7902
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
2.376 ms 270 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
739
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=452)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.359 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
567
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (61, 1071)))
2.337 ms 450 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
681
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=392)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.321 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
823
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=537)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.316 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
618
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=325)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.291 ms 540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
86
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 58200 AND id_shop=1 LIMIT 1
2.255 ms 1 /classes/Product.php:6870
709
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=421)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.244 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
713
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=425)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.243 ms 840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
816
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=529)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.225 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
261
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33120)
2.200 ms 1 /classes/Product.php:3860
794
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=507)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.177 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
780
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=493)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.175 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
675
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=386)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.175 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
829
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=543)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.168 ms 120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
738
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=451)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.167 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
604
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=309)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.142 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
688
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=399)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.090 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
452
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33118) LIMIT 1
2.089 ms 1 /src/Adapter/EntityMapper.php:71
720
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=432)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.083 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
684
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=395)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.056 ms 900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
905
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8234 LIMIT 1
2.031 ms 1 /classes/Product.php:5655
666
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=376)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.018 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
793
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=506)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
2.017 ms 360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
782
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=495)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.988 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
9
SELECT SQL_NO_CACHE id_shop
FROM `uag_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
1.972 ms 1 /classes/ObjectModel.php:1729
591
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=296)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.966 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
814
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=527)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.958 ms 540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
757
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=470)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.953 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
23
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*
FROM `uag_feature` f
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1)
ORDER BY f.`position` ASC
1.942 ms 280 Yes /classes/Feature.php:92
706
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=418)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.937 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
895
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33207
AND image_shop.`cover` = 1 LIMIT 1
1.924 ms 1 /classes/Product.php:3570
79
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7902 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
1.906 ms 199 /classes/Category.php:1062
766
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=479)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.905 ms 780 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
839
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=553)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.889 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
834
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=548)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.883 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
919
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 49114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.876 ms 1 /classes/stock/StockAvailable.php:453
677
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=388)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.859 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
651
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=359)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.854 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
694
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=406)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.847 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
423
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=40671
1.833 ms 2 /classes/Tag.php:244
836
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=550)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.821 ms 360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
754
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=467)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.817 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
775
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=488)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.796 ms 540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
692
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=403)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.787 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
696
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=408)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.782 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
926
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 49118 AND id_shop=1 LIMIT 1
1.778 ms 1 /classes/Product.php:6870
835
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=549)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.760 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
635
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=343)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.750 ms 300 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
828
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=542)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.735 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
809
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=522)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.715 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
790
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=503)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.710 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
838
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=552)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.707 ms 240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
596
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=301)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.700 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
599
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=304)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.695 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
664
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=374)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.693 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
701
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=413)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.679 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1185
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33192
1.646 ms 3 /override/classes/Product.php:24
1346
INSERT INTO `uag_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
1.645 ms 1 /classes/ObjectModel.php:622
138
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33111 LIMIT 1
1.641 ms 1 /classes/SpecificPrice.php:435
781
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=494)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.638 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
670
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=380)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.632 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
594
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=299)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.631 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
693
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=405)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.618 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
746
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=459)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.602 ms 420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
572
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM uag_product p INNER JOIN uag_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470
1.599 ms 15 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
822
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=536)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.580 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
894
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33205
ORDER BY f.position ASC
1.568 ms 3 Yes /classes/Product.php:6015
609
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=315)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.566 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1016
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 447 AND c.`nright` >= 470 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
1.557 ms 718 Yes /classes/Category.php:1600
648
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=356)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.555 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
800
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=513)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.550 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
612
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=318)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.543 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
917
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 49114 AND id_shop=1 LIMIT 1
1.537 ms 1 /classes/Product.php:6870
418
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8234 LIMIT 1
1.524 ms 0 /classes/Category.php:1378
585
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=291)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.524 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
727
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=439)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.524 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
642
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=350)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.523 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
784
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=497)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.522 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
805
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=518)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.499 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
751
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=464)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.477 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
785
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=498)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.470 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
744
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=457)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.455 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
580
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=284)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.454 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
671
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=382)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.420 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1118
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33115 LIMIT 1
1.419 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
605
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=310)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.418 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
703
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=415)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.413 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
722
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=434)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.411 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1106
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171029
1.400 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
699
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=411)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.394 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
803
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=516)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.391 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
753
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=466)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.386 ms 180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
600
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=305)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.384 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
610
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=316)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.381 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
581
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=287)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.376 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1101
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_customersignin" LIMIT 1
1.363 ms 1 /classes/module/Module.php:2636
733
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=446)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.359 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1336
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `uag_category` c
INNER JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `uag_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 8
AND nleft >= 447 AND nright <= 470
AND c.id_category IN (
SELECT id_category
FROM `uag_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cl.`name` ASC
1.358 ms 717 Yes /modules/ps_categorytree/ps_categorytree.php:166
824
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=538)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.352 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
389
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.345 ms 1 /classes/stock/StockAvailable.php:778
668
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=378)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.341 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
593
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=298)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.338 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
597
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=302)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.338 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
770
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=483)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.338 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
583
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=289)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.336 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
617
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=324)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.333 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
606
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=311)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.329 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
592
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=297)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.321 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
788
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=501)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.320 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
584
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=290)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.318 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
614
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=320)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.318 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
748
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=461)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.317 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
520
SELECT SQL_NO_CACHE g.id_group as value, gl.name as label FROM `uag_group` g
LEFT JOIN `uag_group_lang` gl ON (g.id_group=gl.id_group AND gl.id_lang="1")
WHERE g.id_group !="1" AND g.id_group !="2"
1.310 ms 6 /modules/ybc_blog/ybc_blog_defines.php:3038
672
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=383)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.304 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1144
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33120 LIMIT 1
1.301 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
717
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=429)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.290 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
637
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=345)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.284 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
611
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=317)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.280 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
624
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=332)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.279 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
639
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=347)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.277 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
613
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=319)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.276 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
650
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=358)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.273 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
625
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=333)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.269 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
689
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=400)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.267 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
845
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-05-08 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM uag_product p
LEFT JOIN uag_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN uag_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN uag_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (33115,33120,33181,33184,33192,33197,33205,33207,43414,49114,49118,49116,49117,49115,68429)
1.265 ms 15 /classes/ProductAssembler.php:95
607
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=312)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.261 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
749
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=462)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.258 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
616
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=323)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.256 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
622
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=329)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.254 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
608
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=314)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.251 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
721
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=433)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.244 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
665
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=375)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.243 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
586
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=292)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.240 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
728
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=440)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.238 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
755
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=468)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.234 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
769
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=482)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.234 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
602
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=307)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.230 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
685
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=396)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.224 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1138
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33120) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
1.223 ms 1 Yes Yes /classes/Product.php:4520
531
SHOW TABLES LIKE "uag_gmcp_1800"
1.217 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
776
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=489)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.214 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
718
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=430)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.204 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
97
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 58200
ORDER BY f.position ASC
1.194 ms 1 Yes /classes/Product.php:6015
849
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33181 LIMIT 1
1.194 ms 1 /classes/SpecificPrice.php:435
726
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=438)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.189 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
588
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=294)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.180 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
615
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=322)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.177 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
787
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=500)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.174 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1350
INSERT INTO `uag_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('814', '5919', '59355781', '', '1', '1', '2024-05-08 14:23:49')
1.170 ms 1 /classes/ObjectModel.php:622
638
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=346)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.167 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
723
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=435)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.164 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
798
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=511)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.163 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
758
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=471)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.159 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
644
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=352)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.156 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
725
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=437)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.155 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
621
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=328)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.154 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
801
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=514)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.143 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
649
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=357)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.140 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
659
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=369)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.140 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
756
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=469)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.139 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `uag_hook` h
WHERE (h.active = 1)
1.138 ms 1128 /classes/Hook.php:1332
745
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=458)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.138 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
587
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=293)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.132 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
765
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=478)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.126 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
826
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=540)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.125 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
724
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=436)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.123 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
804
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=517)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.122 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
719
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=431)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.120 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
582
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=288)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.119 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
598
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=303)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.118 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
655
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=363)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.113 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
789
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=502)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.113 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
641
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=349)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.111 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
658
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=368)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.108 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
779
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=492)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.106 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
763
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=476)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.103 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
619
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=326)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.102 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
657
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=367)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.102 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
620
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=327)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.101 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
656
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=366)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.099 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
640
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=348)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.094 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
731
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=444)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.092 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
831
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=545)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.090 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
825
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=539)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.089 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
501
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33123) LIMIT 1
1.062 ms 1 /src/Adapter/EntityMapper.php:71
767
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=480)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.058 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
632
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=340)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.055 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
653
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=361)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.042 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
645
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=353)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.037 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
827
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=541)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.036 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
777
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=490)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.032 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
808
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=521)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.032 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
783
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=496)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.031 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
806
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=519)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.028 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
832
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=546)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.027 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
802
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=515)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.021 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
652
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=360)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.017 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
729
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=441)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.010 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
759
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=472)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.008 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
662
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=372)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
1.000 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
747
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=460)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.998 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1243
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 43414)
GROUP BY a0.`id_supplier`
0.994 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
876
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33197
AND image_shop.`cover` = 1 LIMIT 1
0.992 ms 1 /classes/Product.php:3570
663
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=373)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.989 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1008
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 68429) AND (b.`id_shop` = 1) LIMIT 1
0.987 ms 1 /src/Adapter/EntityMapper.php:71
647
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=355)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.985 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
646
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=354)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.983 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
628
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=336)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.982 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
768
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=481)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.975 ms 60 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
633
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=341)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.973 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
695
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=407)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.972 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
654
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=362)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.971 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
760
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=473)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.970 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
629
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=337)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.968 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
673
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=384)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.962 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
795
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=508)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.959 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
761
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=474)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.956 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
390
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.955 ms 1 /classes/stock/StockAvailable.php:753
799
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=512)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.955 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
116
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33108 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33108 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.950 ms 0 /classes/Cart.php:1423
636
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=344)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.949 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
797
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=510)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.946 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
661
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=371)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.943 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
660
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=370)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.938 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1002
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49117) AND (b.`id_shop` = 1) LIMIT 1
0.937 ms 1 /src/Adapter/EntityMapper.php:71
631
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=339)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.936 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1085
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 447 AND c.`nright` >= 470 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.935 ms 718 Yes /classes/Category.php:1600
626
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=334)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.920 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
601
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=306)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.911 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
807
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=520)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.910 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
762
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=475)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.903 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
627
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=335)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.896 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
947
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 49117 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 49117 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.891 ms 0 /classes/Cart.php:1423
987
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33207) AND (b.`id_shop` = 1) LIMIT 1
0.891 ms 1 /src/Adapter/EntityMapper.php:71
630
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=338)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.877 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
764
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=477)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.871 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
154
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33113
AND image_shop.`cover` = 1 LIMIT 1
0.869 ms 1 /classes/Product.php:3570
796
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (61, 1071))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=447 AND c.nright<=470 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=509)) AND ((fp_1.id_feature_value IN (61, 1071))) GROUP BY fp.id_feature_value
0.868 ms 450 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `uag_hook`
0.826 ms 1128 /classes/Hook.php:1292
540
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1)
0.812 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:91
48
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `uag_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 7902
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.808 ms 11 Yes Yes /classes/Category.php:924
125
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33109 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33109 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.802 ms 0 /classes/Cart.php:1423
1018
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8218) LIMIT 1
0.801 ms 1 /src/Adapter/EntityMapper.php:71
850
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33181)
0.796 ms 1 /classes/Product.php:3860
293
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 41176 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 41176 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.794 ms 0 /classes/Cart.php:1423
201
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40670
ORDER BY f.position ASC
0.792 ms 4 Yes /classes/Product.php:6015
952
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 49115)
0.791 ms 1 /classes/Product.php:3860
1266
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49118)
GROUP BY a0.`id_supplier`
0.790 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
955
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 49115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.789 ms 1 /classes/stock/StockAvailable.php:453
444
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33117 AND `id_shop` = 1
0.783 ms 1 /src/Adapter/EntityMapper.php:79
523
DESCRIBE uag_ybc_blog_post
0.775 ms 1 /modules/ybc_blog/ybc_blog_defines.php:3141
863
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33184 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33184 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.766 ms 0 /classes/Cart.php:1423
1122
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(32293, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.763 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
89
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.760 ms 2 Yes /classes/tax/TaxRulesTaxManager.php:109
487
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33122 LIMIT 1
0.746 ms 1 /classes/Product.php:1106
1043
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33197) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.741 ms 1 /classes/Product.php:7720
1318
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.737 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
525
SELECT SQL_NO_CACHE ac.id_ets_abancart_campaign
FROM `uag_ets_abancart_campaign` ac
LEFT JOIN `uag_ets_abancart_campaign_country` `cc` ON cc.id_ets_abancart_campaign = ac.id_ets_abancart_campaign
LEFT JOIN `uag_ets_abancart_campaign_with_lang` `cl` ON cl.id_ets_abancart_campaign = ac.id_ets_abancart_campaign AND cl.id_lang=1
LEFT JOIN `uag_ets_abancart_campaign_group` `acg` ON ac.id_ets_abancart_campaign = acg.id_ets_abancart_campaign
LEFT JOIN `uag_group_shop` `gs` ON gs.id_group = acg.id_group AND gs.id_shop = 1
WHERE (ac.id_shop = 1) AND (ac.enabled = 1 AND ac.deleted = 0) AND (IF(ac.is_all_lang != 1, cl.id_ets_abancart_campaign is NOT NULL AND cl.id_lang=1, 1)) AND (ac.campaign_type != 'email') AND (ac.campaign_type != 'customer') AND (IF(ac.min_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.min_total_cart <= 0, 1) AND IF(ac.max_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.max_total_cart >= 0, 1)) AND (IF(ac.available_from is NOT NULL, ac.available_from <= '2024-05-08', 1) AND IF(ac.available_to is NOT NULL, ac.available_to >= '2024-05-08', 1)) AND (IF(ac.has_applied_voucher = 'both' OR (ac.has_applied_voucher = 'yes' AND 0 > 0) OR (ac.has_applied_voucher = 'no' AND 0 = 0), 1, 0)) AND (IF(ac.has_product_in_cart = 1, 0, 1)) AND (acg.id_group = 1) AND (ac.is_all_country = 1 OR cc.id_country = -1 OR cc.id_country=10)
GROUP BY ac.id_ets_abancart_campaign
0.731 ms 1 Yes /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:407
973
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33181) AND (b.`id_shop` = 1) LIMIT 1
0.724 ms 1 /src/Adapter/EntityMapper.php:71
75
SELECT SQL_NO_CACHE *
FROM `uag_category` a0
LEFT JOIN `uag_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 447) AND (a0.`nright` > 470) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.705 ms 718 Yes /classes/PrestaShopCollection.php:383
861
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33184 AND `id_group` = 1 LIMIT 1
0.700 ms 0 /classes/GroupReduction.php:156
971
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33120
ORDER BY `position`
0.697 ms 1 Yes /classes/Product.php:3545
20
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.693 ms 1 Yes Yes /classes/Supplier.php:139
867
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33192) AND (b.`id_shop` = 1) LIMIT 1
0.691 ms 1 /src/Adapter/EntityMapper.php:71
862
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33184) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.690 ms 1 /classes/stock/StockAvailable.php:453
999
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49116) AND (b.`id_shop` = 1) LIMIT 1
0.686 ms 1 /src/Adapter/EntityMapper.php:71
1000
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 49116
ORDER BY `position`
0.683 ms 1 Yes /classes/Product.php:3545
121
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33109)
0.677 ms 1 /classes/Product.php:3860
152
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33112 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33112 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.675 ms 0 /classes/Cart.php:1423
180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.674 ms 1 /classes/stock/StockAvailable.php:453
478
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33121
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.668 ms 0 /classes/Product.php:1732
546
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.667 ms 1 /classes/Country.php:252
990
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 43414) AND (b.`id_shop` = 1) LIMIT 1
0.666 ms 1 /src/Adapter/EntityMapper.php:71
545
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.662 ms 1 /classes/Country.php:194
976
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33184) AND (b.`id_shop` = 1) LIMIT 1
0.658 ms 1 /src/Adapter/EntityMapper.php:71
1136
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(32293, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.656 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
948
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 49117
ORDER BY f.position ASC
0.646 ms 3 Yes /classes/Product.php:6015
892
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33205) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.646 ms 1 /classes/stock/StockAvailable.php:453
846
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33181
AND image_shop.`cover` = 1 LIMIT 1
0.645 ms 1 /classes/Product.php:3570
161
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33113 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33113 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.631 ms 0 /classes/Cart.php:1423
1017
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33115) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.625 ms 1 /classes/Product.php:7720
854
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33181 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33181 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.624 ms 0 /classes/Cart.php:1423
970
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33120) AND (b.`id_shop` = 1) LIMIT 1
0.624 ms 1 /src/Adapter/EntityMapper.php:71
887
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.623 ms 1 /classes/Product.php:5655
893
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33205 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33205 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.623 ms 0 /classes/Cart.php:1423
447
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33117
0.598 ms 1 /classes/Tag.php:244
352
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33110) LIMIT 1
0.596 ms 1 /src/Adapter/EntityMapper.php:71
884
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33197 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33197 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.595 ms 0 /classes/Cart.php:1423
85
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 58200)
0.592 ms 1 /classes/Product.php:3860
143
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33111 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33111 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.591 ms 0 /classes/Cart.php:1423
1332
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.585 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
953
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 49115 AND id_shop=1 LIMIT 1
0.583 ms 1 /classes/Product.php:6870
888
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33205 LIMIT 1
0.582 ms 1 /classes/SpecificPrice.php:435
978
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33184
0.581 ms 1 /classes/Product.php:2902
965
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 68429 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 68429 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.577 ms 0 /classes/Cart.php:1423
1004
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 49117
0.576 ms 1 /classes/Product.php:2902
981
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33197) AND (b.`id_shop` = 1) LIMIT 1
0.574 ms 1 /src/Adapter/EntityMapper.php:71
956
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 49115 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 49115 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.573 ms 0 /classes/Cart.php:1423
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.572 ms 129 /classes/module/Module.php:345
283
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33122 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33122 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.568 ms 0 /classes/Cart.php:1423
307
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33124) AND (b.`id_shop` = 1) LIMIT 1
0.568 ms 1 /src/Adapter/EntityMapper.php:71
996
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49118) AND (b.`id_shop` = 1) LIMIT 1
0.567 ms 1 /src/Adapter/EntityMapper.php:71
94
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.566 ms 0 /classes/tax/TaxRulesTaxManager.php:109
1065
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 49118) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.565 ms 1 /classes/Product.php:7720
977
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33184
ORDER BY `position`
0.561 ms 1 Yes /classes/Product.php:3545
940
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 49117
AND image_shop.`cover` = 1 LIMIT 1
0.559 ms 1 /classes/Product.php:3570
1248
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.554 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
443
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33117) LIMIT 1
0.549 ms 1 /src/Adapter/EntityMapper.php:71
885
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33197
ORDER BY f.position ASC
0.546 ms 3 Yes /classes/Product.php:6015
939
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 49116
ORDER BY f.position ASC
0.545 ms 3 Yes /classes/Product.php:6015
961
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 68429)
0.540 ms 1 /classes/Product.php:3860
177
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33115)
0.537 ms 1 /classes/Product.php:3860
1003
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 49117
ORDER BY `position`
0.535 ms 1 Yes /classes/Product.php:3545
550
SELECT SQL_NO_CACHE * FROM uag_module_shop WHERE id_module = 109 AND id_shop = 1
0.528 ms 1 /modules/gremarketing/lib/moduleTools.php:403
222
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40673) AND (b.`id_shop` = 1) LIMIT 1
0.527 ms 1 /src/Adapter/EntityMapper.php:71
855
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33181
ORDER BY f.position ASC
0.527 ms 3 Yes /classes/Product.php:6015
1006
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 49115
ORDER BY `position`
0.526 ms 1 Yes /classes/Product.php:3545
1152
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33181) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.526 ms 1 Yes Yes /classes/Product.php:4520
1040
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33192 LIMIT 1
0.525 ms 1 /classes/Product.php:1106
1250
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (49114) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.524 ms 1 Yes Yes /classes/Product.php:4520
1019
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8218 AND `id_shop` = 1
0.522 ms 1 /src/Adapter/EntityMapper.php:79
1155
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28722, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.522 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
265
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33120 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33120 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.520 ms 0 /classes/Cart.php:1423
1236
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (43414) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.519 ms 1 Yes Yes /classes/Product.php:4520
951
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 49115 LIMIT 1
0.517 ms 1 /classes/SpecificPrice.php:435
958
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 68429
AND image_shop.`cover` = 1 LIMIT 1
0.516 ms 4 /classes/Product.php:3570
907
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 43414)
0.514 ms 1 /classes/Product.php:3860
96
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 58200 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 58200 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.512 ms 0 /classes/Cart.php:1423
200
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40670 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40670 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.511 ms 0 /classes/Cart.php:1423
929
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 49118 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 49118 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.511 ms 0 /classes/Cart.php:1423
186
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33116)
0.510 ms 1 /classes/Product.php:3860
541
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.iso_lang="it") AND (ff.id_shop=1)
0.509 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:109
1028
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8235 AND `id_shop` = 1
0.507 ms 1 /src/Adapter/EntityMapper.php:79
1005
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49115) AND (b.`id_shop` = 1) LIMIT 1
0.505 ms 1 /src/Adapter/EntityMapper.php:71
911
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 43414 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 43414 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.504 ms 0 /classes/Cart.php:1423
276
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33122
AND image_shop.`cover` = 1 LIMIT 1
0.503 ms 1 /classes/Product.php:3570
1042
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33197 AND `id_shop` = 1
0.502 ms 1 /src/Adapter/EntityMapper.php:79
1045
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33205) LIMIT 1
0.502 ms 1 /src/Adapter/EntityMapper.php:71
994
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 49114
ORDER BY `position`
0.500 ms 1 Yes /classes/Product.php:3545
107
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33107 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33107 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.499 ms 0 /classes/Cart.php:1423
122
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33109 AND id_shop=1 LIMIT 1
0.499 ms 1 /classes/Product.php:6870
17
SELECT SQL_NO_CACHE name, alias FROM `uag_hook_alias`
0.496 ms 88 /classes/Hook.php:339
492
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 41176) LIMIT 1
0.494 ms 1 /src/Adapter/EntityMapper.php:71
484
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33122) LIMIT 1
0.490 ms 1 /src/Adapter/EntityMapper.php:71
1141
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.489 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
870
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33192)
0.487 ms 1 /classes/Product.php:3860
134
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33110 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33110 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.485 ms 0 /classes/Cart.php:1423
482
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33121) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.484 ms 1 /classes/stock/StockAvailable.php:753
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.483 ms 129 /classes/module/Module.php:345
993
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49114) AND (b.`id_shop` = 1) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
472
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33120
0.482 ms 3 /classes/Tag.php:244
1206
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.482 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
157
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33113)
0.476 ms 1 /classes/Product.php:3860
284
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33122
ORDER BY f.position ASC
0.476 ms 2 Yes /classes/Product.php:6015
938
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 49116 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 49116 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.476 ms 0 /classes/Cart.php:1423
370
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33112
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.475 ms 0 /classes/Product.php:1732
136
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33111
AND image_shop.`cover` = 1 LIMIT 1
0.474 ms 1 /classes/Product.php:3570
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.472 ms 129 /classes/module/Module.php:345
865
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33192
AND image_shop.`cover` = 1 LIMIT 1
0.472 ms 1 /classes/Product.php:3570
488
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33122
0.472 ms 1 /classes/Tag.php:244
345
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33109 AND `id_shop` = 1
0.471 ms 1 /src/Adapter/EntityMapper.php:79
1103
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171029
0.470 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
903
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33207
ORDER BY f.position ASC
0.466 ms 3 Yes /classes/Product.php:6015
144
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33111
ORDER BY f.position ASC
0.466 ms 1 Yes /classes/Product.php:6015
1264
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (49118) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.464 ms 1 Yes Yes /classes/Product.php:4520
984
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33205) AND (b.`id_shop` = 1) LIMIT 1
0.464 ms 1 /src/Adapter/EntityMapper.php:71
27
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.463 ms 129 /classes/module/Module.php:345
988
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33207
ORDER BY `position`
0.462 ms 1 Yes /classes/Product.php:3545
360
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33111) LIMIT 1
0.461 ms 1 /src/Adapter/EntityMapper.php:71
1244
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.461 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
25
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `uag_meta` m
LEFT JOIN `uag_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.460 ms 64 Yes /classes/Dispatcher.php:654
1128
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(32293, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.460 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1306
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (49115) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.459 ms 1 Yes Yes /classes/Product.php:4520
367
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.458 ms 1 /classes/stock/StockAvailable.php:806
1039
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33192) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.458 ms 1 /classes/Product.php:7720
1079
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 68429) LIMIT 1
0.457 ms 1 /src/Adapter/EntityMapper.php:71
1082
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 68429 LIMIT 1
0.456 ms 1 /classes/Product.php:1106
344
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33109) LIMIT 1
0.453 ms 1 /src/Adapter/EntityMapper.php:71
504
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33123 LIMIT 1
0.453 ms 1 /classes/Product.php:1106
355
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33110 LIMIT 1
0.452 ms 1 /classes/Product.php:1106
979
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33192
ORDER BY `position`
0.452 ms 1 Yes /classes/Product.php:3545
1166
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33184) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.451 ms 1 Yes Yes /classes/Product.php:4520
943
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 49117)
0.450 ms 1 /classes/Product.php:3860
1089
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.450 ms 1 /classes/module/Module.php:2636
1194
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33197) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.449 ms 1 Yes Yes /classes/Product.php:4520
182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33115
ORDER BY f.position ASC
0.448 ms 3 Yes /classes/Product.php:6015
1013
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.445 ms 1 /src/Adapter/EntityMapper.php:71
930
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 49118
ORDER BY f.position ASC
0.444 ms 3 Yes /classes/Product.php:6015
1262
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.444 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1135
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33115)
GROUP BY a0.`id_supplier`
0.443 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
851
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33181 AND id_shop=1 LIMIT 1
0.443 ms 1 /classes/Product.php:6870
126
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33109
ORDER BY f.position ASC
0.442 ms 1 Yes /classes/Product.php:6015
1211
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.442 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1351
INSERT INTO `uag_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('623', '', 'www.angoloufficio.it/7902-strumenti-disegno?q=Tipologia-Balaustrone-Doppiodecimetri', '', '2024-05-08 14:23:49')
0.441 ms 1 /classes/ObjectModel.php:622
80
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 58200
AND image_shop.`cover` = 1 LIMIT 1
0.438 ms 1 /classes/Product.php:3570
480
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33121
0.437 ms 2 /classes/Tag.php:244
560
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7902) LIMIT 1
0.436 ms 1 /src/Adapter/EntityMapper.php:71
169
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.434 ms 1 /classes/stock/StockAvailable.php:453
912
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 43414
ORDER BY f.position ASC
0.432 ms 3 Yes /classes/Product.php:6015
441
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 40673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.429 ms 1 /classes/stock/StockAvailable.php:753
1278
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (49116) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.426 ms 1 Yes Yes /classes/Product.php:4520
190
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33116 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33116 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.423 ms 0 /classes/Cart.php:1423
19
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.422 ms 129 /classes/module/Module.php:345
32
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.422 ms 129 /classes/module/Module.php:345
902
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33207 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33207 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.422 ms 0 /classes/Cart.php:1423
985
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33205
ORDER BY `position`
0.420 ms 1 Yes /classes/Product.php:3545
1222
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33207) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.418 ms 1 Yes Yes /classes/Product.php:4520
112
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33108)
0.417 ms 1 /classes/Product.php:3860
1292
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (49117) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.417 ms 1 Yes Yes /classes/Product.php:4520
889
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33205)
0.415 ms 1 /classes/Product.php:3860
1159
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33181)
GROUP BY a0.`id_supplier`
0.413 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
476
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33121) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
1208
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33205) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.410 ms 1 Yes Yes /classes/Product.php:4520
1339
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.410 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
1328
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.410 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
505
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33123
0.409 ms 1 /classes/Tag.php:244
982
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 33197
ORDER BY `position`
0.409 ms 1 Yes /classes/Product.php:3545
170
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33114 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33114 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.407 ms 0 /classes/Cart.php:1423
898
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33207)
0.407 ms 1 /classes/Product.php:3860
1267
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.407 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1271
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49118)
GROUP BY a0.`id_supplier`
0.407 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
966
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 68429
ORDER BY f.position ASC
0.406 ms 3 Yes /classes/Product.php:6015
1033
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33184) LIMIT 1
0.406 ms 1 /src/Adapter/EntityMapper.php:71
108
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33107
ORDER BY f.position ASC
0.404 ms 1 Yes /classes/Product.php:6015
139
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33111)
0.403 ms 1 /classes/Product.php:3860
1220
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.402 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1012
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.400 ms 1 /classes/Category.php:2242
1150
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.400 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
203
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8234 LIMIT 1
0.399 ms 1 /classes/Product.php:5655
1257
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49114)
GROUP BY a0.`id_supplier`
0.397 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
368
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33112) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
1037
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33192) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
303
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33123
ORDER BY f.position ASC
0.395 ms 3 Yes /classes/Product.php:6015
1035
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33184) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.395 ms 1 /classes/Product.php:7720
209
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40671 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40671 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.395 ms 0 /classes/Cart.php:1423
1063
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49118) LIMIT 1
0.395 ms 1 /src/Adapter/EntityMapper.php:71
1323
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.394 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
510
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33124 AND `id_shop` = 1
0.392 ms 1 /src/Adapter/EntityMapper.php:79
997
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 49118
ORDER BY `position`
0.389 ms 1 Yes /classes/Product.php:3545
880
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33197)
0.388 ms 1 /classes/Product.php:3860
162
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33113
ORDER BY f.position ASC
0.387 ms 1 Yes /classes/Product.php:6015
1010
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 68429
0.387 ms 1 /classes/Product.php:2902
1207
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33205 LIMIT 1
0.385 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1239
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.384 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
859
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33184)
0.383 ms 1 /classes/Product.php:3860
117
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33108
ORDER BY f.position ASC
0.382 ms 1 Yes /classes/Product.php:6015
942
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 49117 LIMIT 1
0.378 ms 1 /classes/SpecificPrice.php:435
1104
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.378 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
969
SELECT SQL_NO_CACHE state FROM uag_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.378 ms 1 /classes/FeatureFlag.php:105
165
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33114 LIMIT 1
0.377 ms 1 /classes/SpecificPrice.php:435
181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33115 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33115 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.376 ms 0 /classes/Cart.php:1423
1253
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.374 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
34
SELECT SQL_NO_CACHE * FROM `uag_currency` c ORDER BY `iso_code` ASC
0.371 ms 1 Yes /classes/Currency.php:709
384
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33114) LIMIT 1
0.371 ms 1 /src/Adapter/EntityMapper.php:71
1180
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (33192) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.371 ms 1 Yes Yes /classes/Product.php:4520
1272
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.369 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
266
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33120
ORDER BY f.position ASC
0.368 ms 3 Yes /classes/Product.php:6015
289
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 41176)
0.368 ms 1 /classes/Product.php:3860
354
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33110
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.368 ms 0 /classes/Product.php:1732
1320
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (68429) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.368 ms 1 Yes Yes /classes/Product.php:4520
376
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33113) LIMIT 1
0.367 ms 1 /src/Adapter/EntityMapper.php:71
294
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 41176
ORDER BY f.position ASC
0.366 ms 4 Yes /classes/Product.php:6015
1188
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69301, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.363 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
498
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 41176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:753
115
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:453
489
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33122) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.362 ms 1 /classes/stock/StockAvailable.php:778
1086
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.361 ms 1 /classes/module/Module.php:2636
509
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33124) LIMIT 1
0.360 ms 1 /src/Adapter/EntityMapper.php:71
886
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33205
AND image_shop.`cover` = 1 LIMIT 1
0.359 ms 1 /classes/Product.php:3570
1067
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49116) LIMIT 1
0.359 ms 1 /src/Adapter/EntityMapper.php:71
1309
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.358 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1029
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33181) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
1234
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.357 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1238
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 43414)
GROUP BY a0.`id_supplier`
0.357 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
153
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33112
ORDER BY f.position ASC
0.356 ms 1 Yes /classes/Product.php:6015
175
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33115) AND (b.`id_shop` = 1) LIMIT 1
0.355 ms 1 /src/Adapter/EntityMapper.php:71
21
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.353 ms 1 Yes Yes /classes/Supplier.php:139
1255
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 49114
0.352 ms 3 /override/classes/Product.php:24
463
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33119 LIMIT 1
0.352 ms 1 /classes/Product.php:1106
1202
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.352 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1295
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.351 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
171
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33114
ORDER BY f.position ASC
0.351 ms 1 Yes /classes/Product.php:6015
191
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33116
ORDER BY f.position ASC
0.350 ms 1 Yes /classes/Product.php:6015
238
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33117 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33117 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.350 ms 0 /classes/Cart.php:1423
1192
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69301, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.350 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
922
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 49118
AND image_shop.`cover` = 1 LIMIT 1
0.349 ms 1 /classes/Product.php:3570
1251
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49114 LIMIT 1
0.349 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
218
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40672 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40672 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.348 ms 0 /classes/Cart.php:1423
228
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40673 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40673 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.348 ms 0 /classes/Cart.php:1423
210
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40671
ORDER BY f.position ASC
0.348 ms 4 Yes /classes/Product.php:6015
302
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33123 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33123 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.347 ms 0 /classes/Cart.php:1423
1286
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.347 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1032
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33181 LIMIT 1
0.347 ms 1 /classes/Product.php:1106
1215
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33205)
GROUP BY a0.`id_supplier`
0.347 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
315
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 58200) LIMIT 1
0.346 ms 1 /src/Adapter/EntityMapper.php:71
62
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.345 ms 3 /classes/CartRule.php:357
1165
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33184 LIMIT 1
0.345 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
427
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40672) LIMIT 1
0.342 ms 1 /src/Adapter/EntityMapper.php:71
460
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33119) LIMIT 1
0.341 ms 1 /src/Adapter/EntityMapper.php:71
856
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33184
AND image_shop.`cover` = 1 LIMIT 1
0.341 ms 1 /classes/Product.php:3570
1049
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33207) LIMIT 1
0.341 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33114)
0.339 ms 1 /classes/Product.php:3860
1290
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.339 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1132
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33115 AND `id_group` = 0 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
311
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33124 AND `id_group` = 1 LIMIT 1
0.338 ms 0 /classes/GroupReduction.php:156
1183
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69301, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.338 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
872
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33192 AND `id_group` = 1 LIMIT 1
0.337 ms 0 /classes/GroupReduction.php:156
1276
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.337 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
167
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33114 AND id_shop=1 LIMIT 1
0.336 ms 1 /classes/Product.php:6870
1169
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.336 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
313
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33124 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33124 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.335 ms 0 /classes/Cart.php:1423
1233
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33207)
GROUP BY a0.`id_supplier`
0.335 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
896
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.334 ms 1 /classes/Product.php:5655
1146
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.334 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
155
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.333 ms 1 /classes/Product.php:5655
1197
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.333 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1256
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49114 LIMIT 1
0.333 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1258
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.332 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1231
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33207 AND `id_group` = 0 LIMIT 1
0.332 ms 0 /classes/GroupReduction.php:156
1160
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28722, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.331 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
103
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33107)
0.331 ms 1 /classes/Product.php:3860
229
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40673
ORDER BY f.position ASC
0.329 ms 4 Yes /classes/Product.php:6015
1304
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.327 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
219
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40672
ORDER BY f.position ASC
0.326 ms 4 Yes /classes/Product.php:6015
61
SELECT SQL_NO_CACHE 1 FROM uag_cart_product cp INNER JOIN uag_product p
ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.324 ms 1 /classes/Cart.php:4210
185
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33116 LIMIT 1
0.324 ms 1 /classes/SpecificPrice.php:435
1015
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.324 ms 1 /classes/Category.php:1591
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `uag_lang` l
JOIN uag_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.323 ms 1 /classes/Language.php:1216
256
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33119 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33119 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.323 ms 0 /classes/Cart.php:1423
419
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40671) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
479
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33121 LIMIT 1
0.322 ms 1 /classes/Product.php:1106
927
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49118 AND `id_group` = 1 LIMIT 1
0.322 ms 0 /classes/GroupReduction.php:156
868
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 69301
AND `active` = 1 LIMIT 1
0.322 ms 1 /classes/Manufacturer.php:316
1178
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.321 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
192
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40670
AND image_shop.`cover` = 1 LIMIT 1
0.321 ms 1 /classes/Product.php:3570
1174
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.321 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1340
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 1) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.320 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
1048
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33205 LIMIT 1
0.319 ms 1 /classes/Product.php:1106
1314
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.319 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1225
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.318 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1269
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 49118
0.318 ms 3 /override/classes/Product.php:24
275
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33121
ORDER BY f.position ASC
0.317 ms 3 Yes /classes/Product.php:6015
99
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33107
AND image_shop.`cover` = 1 LIMIT 1
0.316 ms 1 /classes/Product.php:3570
326
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33107) LIMIT 1
0.316 ms 1 /src/Adapter/EntityMapper.php:71
1172
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33184 LIMIT 1
0.315 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
274
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33121 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33121 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.314 ms 0 /classes/Cart.php:1423
322
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 58200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.314 ms 1 /classes/stock/StockAvailable.php:778
468
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33120) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
363
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33111 LIMIT 1
0.313 ms 1 /classes/Product.php:1106
394
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33115
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.312 ms 0 /classes/Product.php:1732
936
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49116 AND `id_group` = 1 LIMIT 1
0.312 ms 0 /classes/GroupReduction.php:156
916
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 49114)
0.312 ms 1 /classes/Product.php:3860
1123
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33115
0.311 ms 3 /classes/Product.php:3423
1105
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.311 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
1121
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33115)
GROUP BY a0.`id_supplier`
0.311 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1124
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33115
0.311 ms 3 /override/classes/Product.php:24
248
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33118
ORDER BY f.position ASC
0.310 ms 3 Yes /classes/Product.php:6015
371
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33112 LIMIT 1
0.310 ms 1 /classes/Product.php:1106
392
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33115) LIMIT 1
0.310 ms 1 /src/Adapter/EntityMapper.php:71
858
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33184 LIMIT 1
0.310 ms 1 /classes/SpecificPrice.php:435
119
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.309 ms 1 /classes/Product.php:5655
564
SELECT SQL_NO_CACHE data FROM uag_layered_filter_block WHERE hash="a9ec9edfd2cc3ac915416754dd807397" LIMIT 1
0.309 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
1300
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.308 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
239
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33117
ORDER BY f.position ASC
0.308 ms 3 Yes /classes/Product.php:6015
247
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 33118 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 33118 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.307 ms 0 /classes/Cart.php:1423
130
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33110)
0.306 ms 1 /classes/Product.php:3860
369
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33112 AND `id_shop` = 1
0.306 ms 1 /src/Adapter/EntityMapper.php:79
1245
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 43414 AND `id_group` = 0 LIMIT 1
0.306 ms 0 /classes/GroupReduction.php:156
163
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33114
AND image_shop.`cover` = 1 LIMIT 1
0.305 ms 1 /classes/Product.php:3570
1230
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.305 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
401
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33116) LIMIT 1
0.304 ms 1 /src/Adapter/EntityMapper.php:71
1036
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33184 LIMIT 1
0.304 ms 1 /classes/Product.php:1106
135
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33110
ORDER BY f.position ASC
0.303 ms 1 Yes /classes/Product.php:6015
356
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33110
0.303 ms 1 /classes/Tag.php:244
445
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33117
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.303 ms 0 /classes/Product.php:1732
517
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8237 LIMIT 1
0.302 ms 0 /classes/Category.php:1378
1127
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33115)
GROUP BY a0.`id_supplier`
0.302 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
409
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40670) LIMIT 1
0.300 ms 1 /src/Adapter/EntityMapper.php:71
502
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33123 AND `id_shop` = 1
0.300 ms 1 /src/Adapter/EntityMapper.php:79
1247
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 43414)
GROUP BY a0.`id_supplier`
0.299 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
257
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33119
ORDER BY f.position ASC
0.297 ms 3 Yes /classes/Product.php:6015
1237
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 43414 LIMIT 1
0.296 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1281
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69192, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.296 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
78
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.295 ms 0 /classes/module/Module.php:2636
1107
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.295 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
148
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33112)
0.294 ms 1 /classes/Product.php:3860
1129
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration` a
WHERE (a.`id_multipleprices_configuration` = 1) LIMIT 1
0.294 ms 1 /src/Adapter/EntityMapper.php:71
425
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 40671) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.293 ms 1 /classes/stock/StockAvailable.php:753
949
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 49115
AND image_shop.`cover` = 1 LIMIT 1
0.292 ms 1 /classes/Product.php:3570
553
SELECT SQL_NO_CACHE `name`
FROM `uag_hook`
WHERE `id_hook` = 1003 LIMIT 1
0.292 ms 1 /classes/Hook.php:244
1151
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33181 LIMIT 1
0.290 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
285
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 41176
AND image_shop.`cover` = 1 LIMIT 1
0.289 ms 1 /classes/Product.php:3570
456
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33118
0.288 ms 1 /classes/Tag.php:244
871
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33192 AND id_shop=1 LIMIT 1
0.288 ms 1 /classes/Product.php:6870
123
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33109 AND `id_group` = 1 LIMIT 1
0.287 ms 0 /classes/GroupReduction.php:156
314
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 33124
ORDER BY f.position ASC
0.287 ms 4 Yes /classes/Product.php:6015
358
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33110) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.286 ms 1 /classes/stock/StockAvailable.php:753
114
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33108 AND `id_group` = 1 LIMIT 1
0.286 ms 0 /classes/GroupReduction.php:156
1066
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 49118 LIMIT 1
0.285 ms 1 /classes/Product.php:1106
64
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.284 ms 3 /classes/CartRule.php:357
118
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33109
AND image_shop.`cover` = 1 LIMIT 1
0.283 ms 1 /classes/Product.php:3570
361
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33111 AND `id_shop` = 1
0.283 ms 1 /src/Adapter/EntityMapper.php:79
440
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 40673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.283 ms 1 /classes/stock/StockAvailable.php:778
503
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33123
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.283 ms 0 /classes/Product.php:1732
883
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33197) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.282 ms 1 /classes/stock/StockAvailable.php:453
1034
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33184 AND `id_shop` = 1
0.281 ms 1 /src/Adapter/EntityMapper.php:79
514
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.281 ms 1 /classes/stock/StockAvailable.php:778
1071
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49117) LIMIT 1
0.279 ms 1 /src/Adapter/EntityMapper.php:71
873
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33192) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.279 ms 1 /classes/stock/StockAvailable.php:453
63
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.278 ms 3 /classes/CartRule.php:423
109
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33108
AND image_shop.`cover` = 1 LIMIT 1
0.278 ms 1 /classes/Product.php:3570
485
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33122 AND `id_shop` = 1
0.278 ms 1 /src/Adapter/EntityMapper.php:79
968
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33115
0.278 ms 1 /classes/Product.php:2902
1088
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `uag_currency` c
LEFT JOIN uag_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.278 ms 1 /classes/Currency.php:1136
287
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8236 LIMIT 1
0.277 ms 1 /classes/Product.php:5655
1053
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 43414) LIMIT 1
0.277 ms 1 /src/Adapter/EntityMapper.php:71
168
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33114 AND `id_group` = 1 LIMIT 1
0.276 ms 0 /classes/GroupReduction.php:156
1168
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33184)
GROUP BY a0.`id_supplier`
0.276 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1216
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28518, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.276 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1249
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 49114 LIMIT 1
0.276 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
934
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 49116)
0.276 ms 1 /classes/Product.php:3860
1241
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 43414
0.275 ms 3 /override/classes/Product.php:24
362
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33111
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.275 ms 0 /classes/Product.php:1732
127
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33110
AND image_shop.`cover` = 1 LIMIT 1
0.274 ms 1 /classes/Product.php:3570
240
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33118
AND image_shop.`cover` = 1 LIMIT 1
0.274 ms 1 /classes/Product.php:3570
493
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 41176 AND `id_shop` = 1
0.273 ms 1 /src/Adapter/EntityMapper.php:79
1038
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33192 AND `id_shop` = 1
0.272 ms 1 /src/Adapter/EntityMapper.php:79
145
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33112
AND image_shop.`cover` = 1 LIMIT 1
0.272 ms 1 /classes/Product.php:3570
353
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33110 AND `id_shop` = 1
0.271 ms 1 /src/Adapter/EntityMapper.php:79
496
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=41176
0.271 ms 2 /classes/Tag.php:244
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM uag_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.271 ms 1 /classes/shop/ShopUrl.php:182
1142
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33120
0.270 ms 3 /classes/Product.php:3423
76
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.268 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
202
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40671
AND image_shop.`cover` = 1 LIMIT 1
0.268 ms 1 /classes/Product.php:3570
477
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33121 AND `id_shop` = 1
0.268 ms 1 /src/Adapter/EntityMapper.php:79
1195
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33197 LIMIT 1
0.268 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1096
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.267 ms 1 /classes/module/Module.php:2109
1149
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33120)
GROUP BY a0.`id_supplier`
0.267 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1161
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33181 AND `id_group` = 0 LIMIT 1
0.267 ms 0 /classes/GroupReduction.php:156
1263
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 49118 LIMIT 1
0.267 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
106
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.266 ms 1 /classes/stock/StockAvailable.php:453
214
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40672)
0.266 ms 1 /classes/Product.php:3860
524
UPDATE `uag_ybc_blog_post` SET enabled=1,datetime_added="2024-05-08 14:23:47",datetime_modified="2024-05-08 14:23:47" WHERE datetime_active!="0000-00-00" AND datetime_active is not NULL AND enabled=2 AND datetime_active<=NOW()
0.266 ms 1 /modules/ybc_blog/classes/ybc_blog_post_class.php:622
1059
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49114) LIMIT 1
0.266 ms 1 /src/Adapter/EntityMapper.php:71
1252
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49114)
GROUP BY a0.`id_supplier`
0.266 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
507
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.265 ms 1 /classes/stock/StockAvailable.php:753
1240
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 43414
0.265 ms 3 /classes/Product.php:3423
183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33116
AND image_shop.`cover` = 1 LIMIT 1
0.264 ms 1 /classes/Product.php:3570
877
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.263 ms 1 /classes/Product.php:5655
1235
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 43414 LIMIT 1
0.262 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `uag_hook_alias`
0.261 ms 88 /classes/Hook.php:287
65
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.261 ms 1 /classes/CartRule.php:423
1099
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitsearch" LIMIT 1
0.261 ms 1 /classes/module/Module.php:2636
1196
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33197)
GROUP BY a0.`id_supplier`
0.261 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
435
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40673) LIMIT 1
0.261 ms 1 /src/Adapter/EntityMapper.php:71
869
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33192 LIMIT 1
0.259 ms 1 /classes/SpecificPrice.php:435
1347
SELECT SQL_NO_CACHE `id_guest`
FROM `uag_connections`
WHERE `id_guest` = 814
AND `date_add` > '2024-05-08 13:53:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.259 ms 1 Yes /classes/Connection.php:168
521
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ybc_blog" LIMIT 1
0.258 ms 1 /classes/module/Module.php:2636
316
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 58200 AND `id_shop` = 1
0.258 ms 1 /src/Adapter/EntityMapper.php:79
6
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.257 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33119)
0.257 ms 1 /classes/Product.php:3860
270
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33121)
0.257 ms 1 /classes/Product.php:3860
458
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.257 ms 1 /classes/stock/StockAvailable.php:753
1335
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.257 ms 1 /classes/module/Module.php:2109
526
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenterpro" LIMIT 1
0.256 ms 1 /classes/module/Module.php:2636
1027
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8235) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
1143
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33120
0.256 ms 3 /override/classes/Product.php:24
1330
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68429 LIMIT 1
0.256 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1064
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 49118 AND `id_shop` = 1
0.256 ms 1 /src/Adapter/EntityMapper.php:79
491
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33122) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.255 ms 1 /classes/stock/StockAvailable.php:806
1075
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 49115) LIMIT 1
0.255 ms 1 /src/Adapter/EntityMapper.php:71
328
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 32293
AND `active` = 1 LIMIT 1
0.255 ms 1 /classes/Manufacturer.php:316
437
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 40673
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.254 ms 0 /classes/Product.php:1732
3
SELECT SQL_NO_CACHE *
FROM `uag_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
891
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33205 AND `id_group` = 1 LIMIT 1
0.252 ms 0 /classes/GroupReduction.php:156
897
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33207 LIMIT 1
0.252 ms 1 /classes/SpecificPrice.php:435
1154
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33181)
GROUP BY a0.`id_supplier`
0.252 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
439
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=40673
0.251 ms 3 /classes/Tag.php:244
451
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8235 LIMIT 1
0.251 ms 0 /classes/Category.php:1378
547
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.251 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM uag_shop_group gs
LEFT JOIN uag_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN uag_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.251 ms 1 Yes /classes/shop/Shop.php:715
336
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 33108) LIMIT 1
0.250 ms 1 /src/Adapter/EntityMapper.php:71
464
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33119
0.250 ms 1 /classes/Tag.php:244
904
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 43414
AND image_shop.`cover` = 1 LIMIT 1
0.250 ms 1 /classes/Product.php:3570
1173
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33184)
GROUP BY a0.`id_supplier`
0.250 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1343
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 4) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.250 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
386
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33114
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.249 ms 0 /classes/Product.php:1732
853
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33181) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.249 ms 1 /classes/stock/StockAvailable.php:453
377
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33113 AND `id_shop` = 1
0.249 ms 1 /src/Adapter/EntityMapper.php:79
1213
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33205
0.249 ms 3 /override/classes/Product.php:24
346
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33109
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.248 ms 0 /classes/Product.php:1732
438
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 40673 LIMIT 1
0.248 ms 1 /classes/Product.php:1106
1024
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 3) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
1261
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49114)
GROUP BY a0.`id_supplier`
0.248 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
111
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33108 LIMIT 1
0.247 ms 1 /classes/SpecificPrice.php:435
321
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=58200
0.247 ms 1 /classes/Tag.php:244
211
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40672
AND image_shop.`cover` = 1 LIMIT 1
0.246 ms 1 /classes/Product.php:3570
348
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33109
0.246 ms 1 /classes/Tag.php:244
1126
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33115 LIMIT 1
0.246 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
465
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33119) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.245 ms 1 /classes/stock/StockAvailable.php:778
1068
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 49116 AND `id_shop` = 1
0.245 ms 1 /src/Adapter/EntityMapper.php:79
1147
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33120 AND `id_group` = 0 LIMIT 1
0.245 ms 0 /classes/GroupReduction.php:156
561
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7902 AND `id_shop` = 1
0.245 ms 1 /src/Adapter/EntityMapper.php:79
1164
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:23:49" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:23:49" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(28722, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.245 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
1344
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 5) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.245 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
1134
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33115 LIMIT 1
0.244 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1349
SELECT SQL_NO_CACHE `id_page`
FROM `uag_page`
WHERE `id_page_type` = 7 AND `id_object` = 7902 LIMIT 1
0.244 ms 1 /classes/Page.php:83
387
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33114 LIMIT 1
0.243 ms 1 /classes/Product.php:1106
1177
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33184)
GROUP BY a0.`id_supplier`
0.243 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1170
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33184
0.243 ms 3 /classes/Product.php:3423
22
SELECT SQL_NO_CACHE DISTINCT g.`id_group`, g.`reduction`, g.`price_display_method`, g.`show_prices`, gl.`name`
FROM `uag_group` g
LEFT JOIN `uag_group_lang` AS gl ON (g.`id_group` = gl.`id_group` AND gl.`id_lang` = 1)
ORDER BY g.`id_group` ASC
0.242 ms 6 Yes /classes/Group.php:111
385
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33114 AND `id_shop` = 1
0.242 ms 1 /src/Adapter/EntityMapper.php:79
156
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33113 LIMIT 1
0.241 ms 1 /classes/SpecificPrice.php:435
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40673)
0.241 ms 1 /classes/Product.php:3860
1060
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 49114 AND `id_shop` = 1
0.241 ms 1 /src/Adapter/EntityMapper.php:79
931
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 49116
AND image_shop.`cover` = 1 LIMIT 1
0.241 ms 1 /classes/Product.php:3570
882
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33197 AND `id_group` = 1 LIMIT 1
0.240 ms 0 /classes/GroupReduction.php:156
160
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.239 ms 1 /classes/stock/StockAvailable.php:453
494
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 41176
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.239 ms 0 /classes/Product.php:1732
1246
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 43414 LIMIT 1
0.239 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1046
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33205 AND `id_shop` = 1
0.239 ms 1 /src/Adapter/EntityMapper.php:79
431
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=40672
0.238 ms 2 /classes/Tag.php:244
453
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33118 AND `id_shop` = 1
0.238 ms 1 /src/Adapter/EntityMapper.php:79
92
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 58200 AND `id_group` = 1 LIMIT 1
0.238 ms 0 /classes/GroupReduction.php:156
277
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.238 ms 1 /classes/Product.php:5655
347
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33109 LIMIT 1
0.237 ms 1 /classes/Product.php:1106
913
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 49114
AND image_shop.`cover` = 1 LIMIT 1
0.237 ms 1 /classes/Product.php:3570
1187
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33192)
GROUP BY a0.`id_supplier`
0.237 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1221
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33207 LIMIT 1
0.237 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1341
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 2) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.237 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
291
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 41176 AND `id_group` = 1 LIMIT 1
0.236 ms 0 /classes/GroupReduction.php:156
339
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33108 LIMIT 1
0.236 ms 1 /classes/Product.php:1106
380
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33113
0.236 ms 1 /classes/Tag.php:244
378
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33113
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.235 ms 0 /classes/Product.php:1732
1097
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcompare" LIMIT 1
0.235 ms 1 /classes/module/Module.php:2636
1025
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 3 AND `id_shop` = 1
0.235 ms 1 /src/Adapter/EntityMapper.php:79
1193
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33197 LIMIT 1
0.235 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
364
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33111
0.234 ms 1 /classes/Tag.php:244
932
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.234 ms 1 /classes/Product.php:5655
964
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 68429) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.234 ms 1 /classes/stock/StockAvailable.php:453
124
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33109) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:453
72
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.233 ms 1 /src/Adapter/EntityMapper.php:71
372
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33112
0.233 ms 1 /classes/Tag.php:244
457
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:778
879
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33197 LIMIT 1
0.233 ms 1 /classes/SpecificPrice.php:435
539
SELECT SQL_NO_CACHE id_feed
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.232 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:75
881
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33197 AND id_shop=1 LIMIT 1
0.232 ms 1 /classes/Product.php:6870
1083
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7902 LIMIT 1
0.232 ms 1 /classes/Category.php:1585
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM uag_shop_url su
LEFT JOIN uag_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.angoloufficio.it' OR su.domain_ssl = 'www.angoloufficio.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.231 ms 1 Yes /classes/shop/Shop.php:1364
333
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.231 ms 1 /classes/stock/StockAvailable.php:753
461
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33119 AND `id_shop` = 1
0.231 ms 1 /src/Adapter/EntityMapper.php:79
462
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33119
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.231 ms 0 /classes/Product.php:1732
532
CREATE TABLE IF NOT EXISTS `uag_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.231 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1175
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33184 AND `id_group` = 0 LIMIT 1
0.231 ms 0 /classes/GroupReduction.php:156
481
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33121) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.230 ms 1 /classes/stock/StockAvailable.php:778
304
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33124
AND image_shop.`cover` = 1 LIMIT 1
0.230 ms 1 /classes/Product.php:3570
1131
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.230 ms 0 /classes/tax/TaxRulesTaxManager.php:109
1334
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.229 ms 1 /classes/module/Module.php:2636
1345
SELECT SQL_NO_CACHE *
FROM `uag_cms` a
LEFT JOIN `uag_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `uag_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) AND (b.`id_shop` = 1) LIMIT 1
0.229 ms 1 /src/Adapter/EntityMapper.php:71
120
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33109 LIMIT 1
0.228 ms 1 /classes/SpecificPrice.php:435
243
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33118)
0.228 ms 1 /classes/Product.php:3860
340
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33108
0.228 ms 1 /classes/Tag.php:244
471
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33120 LIMIT 1
0.227 ms 1 /classes/Product.php:1106
33
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7902) AND (b.`id_shop` = 1) LIMIT 1
0.227 ms 1 /src/Adapter/EntityMapper.php:71
279
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33122)
0.227 ms 1 /classes/Product.php:3860
426
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 40671) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.227 ms 1 /classes/stock/StockAvailable.php:806
548
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 19
0.227 ms 1 /src/Adapter/EntityMapper.php:79
1191
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33192)
GROUP BY a0.`id_supplier`
0.227 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
375
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33112) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.226 ms 1 /classes/stock/StockAvailable.php:806
511
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33124
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.226 ms 0 /classes/Product.php:1732
267
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33121
AND image_shop.`cover` = 1 LIMIT 1
0.225 ms 1 /classes/Product.php:3570
379
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33113 LIMIT 1
0.225 ms 1 /classes/Product.php:1106
1260
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49114 LIMIT 1
0.225 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
220
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40673
AND image_shop.`cover` = 1 LIMIT 1
0.225 ms 1 /classes/Product.php:3570
55
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8238) AND (b.`id_shop` = 1) LIMIT 1
0.224 ms 1 /src/Adapter/EntityMapper.php:71
544
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.224 ms 1 /classes/Currency.php:893
393
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33115 AND `id_shop` = 1
0.224 ms 1 /src/Adapter/EntityMapper.php:79
497
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 41176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.223 ms 1 /classes/stock/StockAvailable.php:778
866
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.223 ms 1 /classes/Product.php:5655
1179
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33192 LIMIT 1
0.223 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1198
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33197
0.222 ms 3 /classes/Product.php:3423
255
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33119) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.222 ms 1 /classes/stock/StockAvailable.php:453
901
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33207) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.221 ms 1 /classes/stock/StockAvailable.php:453
132
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33110 AND `id_group` = 1 LIMIT 1
0.220 ms 0 /classes/GroupReduction.php:156
1080
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 68429 AND `id_shop` = 1
0.220 ms 1 /src/Adapter/EntityMapper.php:79
549
SELECT SQL_NO_CACHE id_module as id, active FROM uag_module WHERE name = "gmerchantcenterpro" AND active = 1
0.219 ms 1 /modules/gremarketing/lib/moduleTools.php:398
1069
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 49116) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.219 ms 1 /classes/Product.php:7720
899
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33207 AND id_shop=1 LIMIT 1
0.219 ms 1 /classes/Product.php:6870
1229
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33207)
GROUP BY a0.`id_supplier`
0.219 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `uag_lang` l
LEFT JOIN `uag_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.218 ms 1 /classes/Language.php:1080
396
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33115
0.218 ms 1 /classes/Tag.php:244
490
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33122) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.218 ms 1 /classes/stock/StockAvailable.php:753
1259
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49114 AND `id_group` = 0 LIMIT 1
0.218 ms 0 /classes/GroupReduction.php:156
298
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33123)
0.216 ms 1 /classes/Product.php:3860
412
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 40670
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.216 ms 0 /classes/Product.php:1732
518
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund` gf
WHERE (gf.shop_id=1) AND (gf.sent= "0") LIMIT 1
0.216 ms 1 /modules/ganalyticspro/models/orderRefund.php:105
1011
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c WHERE c.id_category = 7902 LIMIT 1
0.216 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
1020
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.216 ms 1 /src/Adapter/EntityMapper.php:71
1205
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33197)
GROUP BY a0.`id_supplier`
0.216 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
373
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33112) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.215 ms 1 /classes/stock/StockAvailable.php:778
928
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 49118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.215 ms 1 /classes/stock/StockAvailable.php:453
230
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33117
AND image_shop.`cover` = 1 LIMIT 1
0.214 ms 1 /classes/Product.php:3570
923
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.214 ms 1 /classes/Product.php:5655
960
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 68429 LIMIT 1
0.214 ms 1 /classes/SpecificPrice.php:435
90
SELECT SQL_NO_CACHE *
FROM `uag_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
1062
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 49114 LIMIT 1
0.213 ms 1 /classes/Product.php:1106
1219
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33205)
GROUP BY a0.`id_supplier`
0.213 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1242
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 43414 LIMIT 1
0.213 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
140
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33111 AND id_shop=1 LIMIT 1
0.212 ms 1 /classes/Product.php:6870
205
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40671)
0.212 ms 1 /classes/Product.php:3860
1311
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 49115
0.212 ms 4 /override/classes/Product.php:24
196
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40670)
0.211 ms 1 /classes/Product.php:3860
264
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.211 ms 1 /classes/stock/StockAvailable.php:453
542
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'IT' LIMIT 1
0.211 ms 1 /classes/Country.php:194
933
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 49116 LIMIT 1
0.211 ms 1 /classes/SpecificPrice.php:435
1026
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33120) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.211 ms 1 /classes/Product.php:7720
1232
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33207 LIMIT 1
0.211 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
522
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 120 AND `id_shop` = 1 LIMIT 1
0.210 ms 1 /classes/module/Module.php:2109
56
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8242) AND (b.`id_shop` = 1) LIMIT 1
0.209 ms 1 /src/Adapter/EntityMapper.php:71
60
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_accounts" LIMIT 1
0.209 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
204
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 40671 LIMIT 1
0.209 ms 1 /classes/SpecificPrice.php:435
529
SELECT SQL_NO_CACHE * FROM `uag_image_type`
0.208 ms 8 /classes/ImageType.php:161
878
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 69192
AND `active` = 1 LIMIT 1
0.208 ms 1 /classes/Manufacturer.php:316
962
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 68429 AND id_shop=1 LIMIT 1
0.208 ms 1 /classes/Product.php:6870
446
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33117 LIMIT 1
0.207 ms 1 /classes/Product.php:1106
288
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 41176 LIMIT 1
0.206 ms 1 /classes/SpecificPrice.php:435
366
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:753
941
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.206 ms 1 /classes/Product.php:5655
1140
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33120)
GROUP BY a0.`id_supplier`
0.206 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
95
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 58200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.205 ms 1 /classes/stock/StockAvailable.php:453
519
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund_partial` grf
WHERE (grf.shop_id=1) AND (grf.sent= "0") LIMIT 1
0.205 ms 1 /modules/ganalyticspro/models/orderPartialRefund.php:105
1199
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33197
0.205 ms 3 /override/classes/Product.php:24
357
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33110) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.205 ms 1 /classes/stock/StockAvailable.php:778
327
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33107 AND `id_shop` = 1
0.204 ms 1 /src/Adapter/EntityMapper.php:79
1014
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7902 LIMIT 1
0.204 ms 1 /classes/Category.php:1585
151
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33112) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.204 ms 1 /classes/stock/StockAvailable.php:453
890
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33205 AND id_shop=1 LIMIT 1
0.204 ms 1 /classes/Product.php:6870
1210
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33205)
GROUP BY a0.`id_supplier`
0.203 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
102
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33107 LIMIT 1
0.203 ms 1 /classes/SpecificPrice.php:435
142
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.203 ms 1 /classes/stock/StockAvailable.php:453
857
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.203 ms 1 /classes/Product.php:5655
1030
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33181 AND `id_shop` = 1
0.203 ms 1 /src/Adapter/EntityMapper.php:79
1070
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 49116 LIMIT 1
0.203 ms 1 /classes/Product.php:1106
495
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 41176 LIMIT 1
0.202 ms 1 /classes/Product.php:1106
995
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 49114
0.202 ms 1 /classes/Product.php:2902
1305
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 49115 LIMIT 1
0.202 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1337
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.201 ms 1 /classes/module/Module.php:2636
129
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33110 LIMIT 1
0.201 ms 1 /classes/SpecificPrice.php:435
365
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33111) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:778
410
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 40670 AND `id_shop` = 1
0.201 ms 1 /src/Adapter/EntityMapper.php:79
420
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 40671 AND `id_shop` = 1
0.201 ms 1 /src/Adapter/EntityMapper.php:79
429
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 40672
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.201 ms 0 /classes/Product.php:1732
1023
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7843 AND `id_shop` = 1
0.201 ms 1 /src/Adapter/EntityMapper.php:79
309
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33124)
0.200 ms 1 /classes/Product.php:3860
483
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33121) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.200 ms 1 /classes/stock/StockAvailable.php:806
954
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49115 AND `id_group` = 1 LIMIT 1
0.200 ms 0 /classes/GroupReduction.php:156
1125
SELECT SQL_NO_CACHE `id_zone`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.200 ms 1 /classes/Country.php:224
1268
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 49118
0.200 ms 3 /classes/Product.php:3423
52
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8235) AND (b.`id_shop` = 1) LIMIT 1
0.199 ms 1 /src/Adapter/EntityMapper.php:71
53
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8236) AND (b.`id_shop` = 1) LIMIT 1
0.199 ms 1 /src/Adapter/EntityMapper.php:71
68
SELECT SQL_NO_CACHE * FROM `uag_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.199 ms 8 Yes /classes/ImageType.php:109
1325
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 68429
0.199 ms 3 /override/classes/Product.php:24
860
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33184 AND id_shop=1 LIMIT 1
0.199 ms 1 /classes/Product.php:6870
342
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:753
900
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33207 AND `id_group` = 1 LIMIT 1
0.198 ms 0 /classes/GroupReduction.php:156
374
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33112) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:753
381
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:778
178
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33115 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6870
516
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.197 ms 1 /classes/stock/StockAvailable.php:806
1052
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33207 LIMIT 1
0.197 ms 1 /classes/Product.php:1106
104
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33107 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6870
131
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33110 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6870
454
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33118
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.197 ms 0 /classes/Product.php:1732
1171
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33184
0.197 ms 3 /override/classes/Product.php:24
1342
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 3) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.197 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
199
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 40670) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
273
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33121) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:453
341
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:778
349
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33109) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.196 ms 1 /classes/stock/StockAvailable.php:778
329
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33107
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.195 ms 0 /classes/Product.php:1732
1001
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 49116
0.195 ms 1 /classes/Product.php:2902
1277
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 49116 LIMIT 1
0.195 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
403
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33116
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.195 ms 0 /classes/Product.php:1732
295
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33123
AND image_shop.`cover` = 1 LIMIT 1
0.194 ms 1 /classes/Product.php:3570
448
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:778
455
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33118 LIMIT 1
0.193 ms 1 /classes/Product.php:1106
100
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8217 LIMIT 1
0.193 ms 1 /classes/Category.php:1378
280
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33122 AND id_shop=1 LIMIT 1
0.193 ms 1 /classes/Product.php:6870
486
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33122
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.193 ms 0 /classes/Product.php:1732
1137
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 33120 LIMIT 1
0.193 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
141
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33111 AND `id_group` = 1 LIMIT 1
0.192 ms 0 /classes/GroupReduction.php:156
172
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33115
AND image_shop.`cover` = 1 LIMIT 1
0.192 ms 1 /classes/Product.php:3570
323
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 58200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:753
404
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33116 LIMIT 1
0.192 ms 1 /classes/Product.php:1106
442
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 40673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.192 ms 1 /classes/stock/StockAvailable.php:806
1111
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.192 ms 1 /classes/module/Module.php:2636
1056
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8234) LIMIT 1
0.191 ms 1 /src/Adapter/EntityMapper.php:71
324
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 58200) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.190 ms 1 /classes/stock/StockAvailable.php:806
543
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 10 LIMIT 1
0.190 ms 1 /classes/Country.php:252
1303
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49117)
GROUP BY a0.`id_supplier`
0.190 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1308
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49115)
GROUP BY a0.`id_supplier`
0.190 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
436
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 40673 AND `id_shop` = 1
0.189 ms 1 /src/Adapter/EntityMapper.php:79
852
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33181 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
1148
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33120 LIMIT 1
0.189 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
179
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33115 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
473
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:778
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM uag_shop s
LEFT JOIN uag_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.188 ms 1 /classes/shop/Shop.php:218
113
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33108 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6870
350
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33109) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:753
359
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33110) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:806
383
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:806
1072
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 49117 AND `id_shop` = 1
0.188 ms 1 /src/Adapter/EntityMapper.php:79
1145
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33120)
GROUP BY a0.`id_supplier`
0.188 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
158
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33113 AND id_shop=1 LIMIT 1
0.188 ms 1 /classes/Product.php:6870
959
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.188 ms 1 /classes/Product.php:5655
1120
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33115 LIMIT 1
0.188 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
38
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.187 ms 1 /src/Adapter/EntityMapper.php:71
164
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.187 ms 1 /classes/Product.php:5655
1156
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33181
0.187 ms 3 /classes/Product.php:3423
1275
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49118)
GROUP BY a0.`id_supplier`
0.187 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1287
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49116 AND `id_group` = 0 LIMIT 1
0.187 ms 0 /classes/GroupReduction.php:156
197
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 40670 AND id_shop=1 LIMIT 1
0.186 ms 1 /classes/Product.php:6870
249
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33119
AND image_shop.`cover` = 1 LIMIT 1
0.186 ms 1 /classes/Product.php:3570
382
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33113) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:753
73
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 10
0.185 ms 1 /src/Adapter/EntityMapper.php:79
81
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8287 LIMIT 1
0.185 ms 1 /classes/Category.php:1378
110
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.185 ms 1 /classes/Product.php:5655
338
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33108
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.185 ms 0 /classes/Product.php:1732
422
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 40671 LIMIT 1
0.185 ms 1 /classes/Product.php:1106
93
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 1 LIMIT 1
0.184 ms 1 /classes/Group.php:154
146
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.184 ms 1 /classes/Product.php:5655
343
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33108) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:806
351
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33109) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:806
1084
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.184 ms 1 /classes/Category.php:1591
946
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 49117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
49
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8217) AND (b.`id_shop` = 1) LIMIT 1
0.183 ms 1 /src/Adapter/EntityMapper.php:71
237
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.183 ms 1 /classes/stock/StockAvailable.php:453
1091
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.183 ms 1 /classes/module/Module.php:2636
1291
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 49117 LIMIT 1
0.183 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
91
SELECT SQL_NO_CACHE *
FROM `uag_tax_lang`
WHERE `id_tax` = 1
0.182 ms 1 /src/Adapter/EntityMapper.php:79
262
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33120 AND id_shop=1 LIMIT 1
0.182 ms 1 /classes/Product.php:6870
421
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 40671
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.181 ms 0 /classes/Product.php:1732
66
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.180 ms 0 /classes/module/Module.php:2636
1050
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33207 AND `id_shop` = 1
0.180 ms 1 /src/Adapter/EntityMapper.php:79
1157
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33181
0.179 ms 3 /override/classes/Product.php:24
1181
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33192 LIMIT 1
0.179 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1022
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7843) LIMIT 1
0.178 ms 1 /src/Adapter/EntityMapper.php:71
312
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:453
432
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 40672) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:778
1297
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 49117
0.178 ms 3 /override/classes/Product.php:24
1319
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 68429 LIMIT 1
0.178 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
1102
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 8 AND `id_shop` = 1 LIMIT 1
0.177 ms 1 /classes/module/Module.php:2109
1285
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49116)
GROUP BY a0.`id_supplier`
0.177 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
395
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33115 LIMIT 1
0.176 ms 1 /classes/Product.php:1106
1327
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68429)
GROUP BY a0.`id_supplier`
0.176 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
8
SELECT SQL_NO_CACHE *
FROM `uag_lang` a
LEFT JOIN `uag_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
101
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.175 ms 1 /classes/Product.php:5655
258
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 33120
AND image_shop.`cover` = 1 LIMIT 1
0.175 ms 1 /classes/Product.php:3570
331
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33107
0.175 ms 1 /classes/Tag.php:244
972
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33120
0.175 ms 1 /classes/Product.php:2902
57
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8246) AND (b.`id_shop` = 1) LIMIT 1
0.174 ms 1 /src/Adapter/EntityMapper.php:71
176
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33115 LIMIT 1
0.174 ms 1 /classes/SpecificPrice.php:435
325
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8287 LIMIT 1
0.174 ms 0 /classes/Category.php:1378
449
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:753
1167
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33184 LIMIT 1
0.174 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
83
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 0 LIMIT 1
0.174 ms 1 /classes/SpecificPrice.php:426
77
SELECT SQL_NO_CACHE * FROM uag_revslider_sliders
0.173 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
400
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8218 LIMIT 1
0.173 ms 0 /classes/Category.php:1378
406
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:778
58
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8248) AND (b.`id_shop` = 1) LIMIT 1
0.172 ms 1 /src/Adapter/EntityMapper.php:71
512
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33124 LIMIT 1
0.172 ms 1 /classes/Product.php:1106
1296
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 49117
0.172 ms 3 /classes/Product.php:3423
1324
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 68429
0.172 ms 3 /classes/Product.php:3423
105
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33107 AND `id_group` = 1 LIMIT 1
0.172 ms 0 /classes/GroupReduction.php:156
292
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 41176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.172 ms 1 /classes/stock/StockAvailable.php:453
1081
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 68429) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.171 ms 1 /classes/Product.php:7720
1163
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33181)
GROUP BY a0.`id_supplier`
0.171 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
278
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33122 LIMIT 1
0.170 ms 1 /classes/SpecificPrice.php:435
983
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33197
0.170 ms 1 /classes/Product.php:2902
1007
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 49115
0.170 ms 1 /classes/Product.php:2902
1115
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c LEFT JOIN uag_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 7902 AND s.id_shop = 1 LIMIT 1
0.170 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
1139
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33120 LIMIT 1
0.170 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1153
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33181 LIMIT 1
0.170 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1212
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33205
0.170 ms 3 /classes/Product.php:3423
1021
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.169 ms 1 /src/Adapter/EntityMapper.php:79
1313
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49115)
GROUP BY a0.`id_supplier`
0.169 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1201
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33197)
GROUP BY a0.`id_supplier`
0.169 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
187
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33116 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6870
397
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.168 ms 1 /classes/stock/StockAvailable.php:778
527
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.168 ms 0 /classes/module/Module.php:2636
1061
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 49114) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.168 ms 1 /classes/Product.php:7720
1158
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33181 LIMIT 1
0.168 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1214
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33205 LIMIT 1
0.168 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
428
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 40672 AND `id_shop` = 1
0.168 ms 1 /src/Adapter/EntityMapper.php:79
430
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 40672 LIMIT 1
0.167 ms 1 /classes/Product.php:1106
1289
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49116)
GROUP BY a0.`id_supplier`
0.167 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1317
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49115)
GROUP BY a0.`id_supplier`
0.167 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1331
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68429)
GROUP BY a0.`id_supplier`
0.167 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
195
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 40670 LIMIT 1
0.167 ms 1 /classes/SpecificPrice.php:435
189
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:453
414
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=40670
0.166 ms 2 /classes/Tag.php:244
128
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.166 ms 1 /classes/Product.php:5655
506
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.166 ms 1 /classes/stock/StockAvailable.php:778
1186
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33192 LIMIT 1
0.166 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1310
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 49115
0.166 ms 3 /classes/Product.php:3423
50
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8218) AND (b.`id_shop` = 1) LIMIT 1
0.165 ms 1 /src/Adapter/EntityMapper.php:71
450
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33117) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.165 ms 1 /classes/stock/StockAvailable.php:806
469
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33120 AND `id_shop` = 1
0.165 ms 1 /src/Adapter/EntityMapper.php:79
301
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.164 ms 1 /classes/stock/StockAvailable.php:453
1294
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49117)
GROUP BY a0.`id_supplier`
0.164 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
7
SELECT SQL_NO_CACHE *
FROM `uag_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
236
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33117 AND `id_group` = 1 LIMIT 1
0.163 ms 0 /classes/GroupReduction.php:156
320
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 58200 LIMIT 1
0.163 ms 1 /classes/Product.php:1106
950
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.163 ms 1 /classes/Product.php:5655
332
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 33107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.162 ms 1 /classes/stock/StockAvailable.php:778
1209
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33205 LIMIT 1
0.162 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
513
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33124
0.162 ms 1 /classes/Tag.php:244
534
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.162 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1078
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 49115 LIMIT 1
0.162 ms 1 /classes/Product.php:1106
1182
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33192)
GROUP BY a0.`id_supplier`
0.162 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1265
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49118 LIMIT 1
0.162 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
989
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33207
0.161 ms 1 /classes/Product.php:2902
1227
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 33207
0.161 ms 3 /override/classes/Product.php:24
337
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33108 AND `id_shop` = 1
0.161 ms 1 /src/Adapter/EntityMapper.php:79
402
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 33116 AND `id_shop` = 1
0.161 ms 1 /src/Adapter/EntityMapper.php:79
1058
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 43414 LIMIT 1
0.161 ms 1 /classes/Product.php:1106
1283
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 49116
0.161 ms 3 /override/classes/Product.php:24
433
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 40672) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:753
1110
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1
0.160 ms 1 /classes/module/Module.php:2109
1116
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitreviews" LIMIT 1
0.160 ms 1 /classes/module/Module.php:2636
1270
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49118 LIMIT 1
0.160 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
51
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8234) AND (b.`id_shop` = 1) LIMIT 1
0.159 ms 1 /src/Adapter/EntityMapper.php:71
405
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=33116
0.159 ms 1 /classes/Tag.php:244
556
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7902
AND `id_shop` = 1 LIMIT 1
0.159 ms 1 /classes/Category.php:2450
963
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 68429 AND `id_group` = 1 LIMIT 1
0.159 ms 0 /classes/GroupReduction.php:156
1218
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33205 LIMIT 1
0.159 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
286
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8236 LIMIT 1
0.158 ms 1 /classes/Category.php:1378
413
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 40670 LIMIT 1
0.158 ms 1 /classes/Product.php:1106
908
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 43414 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6870
208
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 40671) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.157 ms 1 /classes/stock/StockAvailable.php:453
234
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 33117)
0.157 ms 1 /classes/Product.php:3860
1226
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33207
0.157 ms 3 /classes/Product.php:3423
263
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33120 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
306
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8237 LIMIT 1
0.157 ms 1 /classes/Product.php:5655
944
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 49117 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6870
924
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 49118 LIMIT 1
0.156 ms 1 /classes/SpecificPrice.php:435
40
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.156 ms 1 /src/Adapter/EntityMapper.php:71
215
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 40672 AND id_shop=1 LIMIT 1
0.156 ms 1 /classes/Product.php:6870
914
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.156 ms 1 /classes/Product.php:5655
1054
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 43414 AND `id_shop` = 1
0.156 ms 1 /src/Adapter/EntityMapper.php:79
1315
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49115 AND `id_group` = 0 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
528
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.155 ms 0 /classes/module/Module.php:2636
184
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8217 LIMIT 1
0.155 ms 1 /classes/Product.php:5655
223
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 40673 LIMIT 1
0.155 ms 1 /classes/SpecificPrice.php:435
975
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33181
0.155 ms 1 /classes/Product.php:2902
1273
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49118 AND `id_group` = 0 LIMIT 1
0.155 ms 0 /classes/GroupReduction.php:156
1274
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49118 LIMIT 1
0.154 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
54
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8237) AND (b.`id_shop` = 1) LIMIT 1
0.153 ms 1 /src/Adapter/EntityMapper.php:71
1254
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 49114
0.153 ms 3 /classes/Product.php:3423
910
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 43414) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:453
391
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:806
424
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 40671) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:778
1204
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33197 LIMIT 1
0.152 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1113
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitelementor" LIMIT 1
0.151 ms 1 /classes/module/Module.php:2636
1322
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 68429)
GROUP BY a0.`id_supplier`
0.151 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
319
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 58200
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.150 ms 0 /classes/Product.php:1732
459
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:806
1090
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.150 ms 1 /classes/module/Module.php:2109
915
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 49114 LIMIT 1
0.149 ms 1 /classes/SpecificPrice.php:435
1098
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.149 ms 1 /classes/module/Module.php:2109
43
SELECT SQL_NO_CACHE *
FROM `uag_group` a
LEFT JOIN `uag_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.148 ms 1 /src/Adapter/EntityMapper.php:71
937
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 49116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:453
980
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33192
0.148 ms 1 /classes/Product.php:2902
1100
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.148 ms 1 /classes/module/Module.php:2109
1133
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 0 LIMIT 1
0.148 ms 0 /classes/Group.php:154
193
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8234 LIMIT 1
0.148 ms 1 /classes/Category.php:1378
308
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33124 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
36
SELECT SQL_NO_CACHE value FROM `uag_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.147 ms 1 /classes/shop/Shop.php:1183
1093
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.147 ms 1 /classes/module/Module.php:2636
1184
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 33192
0.147 ms 3 /classes/Product.php:3423
1190
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33192 LIMIT 1
0.147 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
992
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 43414
0.146 ms 1 /classes/Product.php:2902
227
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 40673) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
246
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33118) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:453
466
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33119) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:753
515
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:753
1076
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 49115 AND `id_shop` = 1
0.145 ms 1 /src/Adapter/EntityMapper.php:79
1280
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49116)
GROUP BY a0.`id_supplier`
0.145 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
133
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33110) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.144 ms 1 /classes/stock/StockAvailable.php:453
1307
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49115 LIMIT 1
0.144 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
415
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 40670) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:778
847
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.143 ms 1 /classes/Product.php:5655
1112
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.143 ms 1 /classes/module/Module.php:2109
470
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 33120
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.143 ms 0 /classes/Product.php:1732
1074
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 49117 LIMIT 1
0.143 ms 1 /classes/Product.php:1106
1108
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.143 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
1282
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 49116
0.142 ms 3 /classes/Product.php:3423
1302
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49117 LIMIT 1
0.142 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
281
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33122 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
535
CREATE TABLE IF NOT EXISTS `uag_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.142 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
300
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33123 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
399
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
434
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 40672) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
998
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 49118
0.141 ms 1 /classes/Product.php:2902
254
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33119 AND `id_group` = 1 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
1203
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33197 AND `id_group` = 0 LIMIT 1
0.141 ms 0 /classes/GroupReduction.php:156
150
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33112 AND `id_group` = 1 LIMIT 1
0.140 ms 0 /classes/GroupReduction.php:156
1329
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 68429 AND `id_group` = 0 LIMIT 1
0.140 ms 0 /classes/GroupReduction.php:156
290
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 41176 AND id_shop=1 LIMIT 1
0.140 ms 1 /classes/Product.php:6870
330
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 33107 LIMIT 1
0.139 ms 1 /classes/Product.php:1106
848
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28722
AND `active` = 1 LIMIT 1
0.139 ms 1 /classes/Manufacturer.php:316
1224
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 33207)
GROUP BY a0.`id_supplier`
0.139 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
1312
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49115 LIMIT 1
0.139 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
59
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8287) AND (b.`id_shop` = 1) LIMIT 1
0.138 ms 1 /src/Adapter/EntityMapper.php:71
299
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33123 AND id_shop=1 LIMIT 1
0.138 ms 1 /classes/Product.php:6870
533
CREATE TABLE IF NOT EXISTS `uag_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.138 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1031
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33181) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.138 ms 1 /classes/Product.php:7720
1189
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33192 AND `id_group` = 0 LIMIT 1
0.138 ms 0 /classes/GroupReduction.php:156
1288
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49116 LIMIT 1
0.138 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
310
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33124 AND id_shop=1 LIMIT 1
0.138 ms 1 /classes/Product.php:6870
411
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28518
AND `active` = 1 LIMIT 1
0.137 ms 1 /classes/Manufacturer.php:316
1092
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.137 ms 1 /classes/module/Module.php:2109
1316
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49115 LIMIT 1
0.137 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1326
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68429 LIMIT 1
0.137 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1348
SELECT SQL_NO_CACHE id_page_type
FROM uag_page_type
WHERE name = 'category' LIMIT 1
0.137 ms 1 /classes/Page.php:104
1279
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49116 LIMIT 1
0.136 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1176
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33184 LIMIT 1
0.136 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
84
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 58200 LIMIT 1
0.135 ms 1 /classes/SpecificPrice.php:435
250
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.135 ms 1 /classes/Product.php:5655
194
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8234 LIMIT 1
0.134 ms 1 /classes/Product.php:5655
217
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 40672) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:453
499
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 41176) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:806
282
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 33122) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.133 ms 1 /classes/stock/StockAvailable.php:453
1298
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49117 LIMIT 1
0.133 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1338
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.133 ms 1 /classes/module/Module.php:2109
1162
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33181 LIMIT 1
0.133 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
1200
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33197 LIMIT 1
0.133 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
26
SELECT SQL_NO_CACHE * FROM `uag_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.132 ms 1 /classes/module/Module.php:2018
35
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.132 ms 1 /classes/Language.php:883
149
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33112 AND id_shop=1 LIMIT 1
0.132 ms 1 /classes/Product.php:6870
551
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenter" LIMIT 1
0.132 ms 0 /classes/module/Module.php:2636
398
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:753
1284
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49116 LIMIT 1
0.131 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
67
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.131 ms 0 /classes/module/Module.php:2109
918
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49114 AND `id_group` = 1 LIMIT 1
0.130 ms 0 /classes/GroupReduction.php:156
1293
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 49117 LIMIT 1
0.130 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
198
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 40670 AND `id_group` = 1 LIMIT 1
0.129 ms 0 /classes/GroupReduction.php:156
253
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33119 AND id_shop=1 LIMIT 1
0.129 ms 1 /classes/Product.php:6870
536
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.129 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1047
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33205) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.129 ms 1 /classes/Product.php:7720
1077
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 49115) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.129 ms 1 /classes/Product.php:7720
1087
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.129 ms 1 /classes/module/Module.php:2109
271
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33121 AND id_shop=1 LIMIT 1
0.128 ms 1 /classes/Product.php:6870
29
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.128 ms 1 /modules/ps_mbo/ps_mbo.php:335
213
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 40672 LIMIT 1
0.127 ms 1 /classes/SpecificPrice.php:435
1299
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 49117)
GROUP BY a0.`id_supplier`
0.127 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
71
SELECT SQL_NO_CACHE *
FROM `uag_state` a
WHERE (a.`id_state` = 234) LIMIT 1
0.126 ms 1 /src/Adapter/EntityMapper.php:71
206
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 40671 AND id_shop=1 LIMIT 1
0.126 ms 1 /classes/Product.php:6870
242
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33118 LIMIT 1
0.126 ms 1 /classes/SpecificPrice.php:435
46
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7902
AND `id_shop` = 1 LIMIT 1
0.126 ms 1 /classes/Category.php:2450
159
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33113 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
317
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28049
AND `active` = 1 LIMIT 1
0.126 ms 1 /classes/Manufacturer.php:316
508
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:806
1217
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33205 AND `id_group` = 0 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
305
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8237 LIMIT 1
0.125 ms 1 /classes/Category.php:1378
334
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33107) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.125 ms 1 /classes/stock/StockAvailable.php:806
1321
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 68429 LIMIT 1
0.125 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
41
SELECT SQL_NO_CACHE *
FROM `uag_currency_lang`
WHERE `id_currency` = 1
0.124 ms 1 /src/Adapter/EntityMapper.php:79
74
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM uag_required_field
0.124 ms 1 /classes/ObjectModel.php:1592
188
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33116 AND `id_group` = 1 LIMIT 1
0.124 ms 0 /classes/GroupReduction.php:156
500
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8236 LIMIT 1
0.124 ms 0 /classes/Category.php:1378
537
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.124 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
1057
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8234 AND `id_shop` = 1
0.124 ms 1 /src/Adapter/EntityMapper.php:79
31
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.123 ms 1 /modules/ps_mbo/ps_mbo.php:335
268
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.123 ms 1 /classes/Product.php:5655
1228
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33207 LIMIT 1
0.123 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
269
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33121 LIMIT 1
0.118 ms 1 /classes/SpecificPrice.php:435
1094
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.118 ms 1 /classes/module/Module.php:2109
231
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8235 LIMIT 1
0.117 ms 1 /classes/Category.php:1378
28
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.116 ms 1 /modules/ps_mbo/ps_mbo.php:325
241
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.116 ms 1 /classes/Product.php:5655
986
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 33205
0.116 ms 1 /classes/Product.php:2902
1109
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.116 ms 1 /classes/module/Module.php:2636
173
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8218 LIMIT 1
0.116 ms 1 /classes/Category.php:1378
407
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.116 ms 1 /classes/stock/StockAvailable.php:753
1301
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49117 AND `id_group` = 0 LIMIT 1
0.116 ms 0 /classes/GroupReduction.php:156
216
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 40672 AND `id_group` = 1 LIMIT 1
0.115 ms 0 /classes/GroupReduction.php:156
232
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.115 ms 1 /classes/Product.php:5655
1095
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.115 ms 1 /classes/module/Module.php:2636
39
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.114 ms 1 /classes/Language.php:883
44
SELECT SQL_NO_CACHE *
FROM `uag_group_lang`
WHERE `id_group` = 1
0.114 ms 1 /src/Adapter/EntityMapper.php:79
296
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8236 LIMIT 1
0.114 ms 1 /classes/Product.php:5655
416
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 40670) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.114 ms 1 /classes/stock/StockAvailable.php:753
467
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33119) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.114 ms 1 /classes/stock/StockAvailable.php:806
1051
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 33207) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.113 ms 1 /classes/Product.php:7720
1073
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 49117) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.113 ms 1 /classes/Product.php:7720
1223
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 33207 LIMIT 1
0.113 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
297
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33123 LIMIT 1
0.112 ms 1 /classes/SpecificPrice.php:435
335
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8217 LIMIT 1
0.112 ms 0 /classes/Category.php:1378
207
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 40671 AND `id_group` = 1 LIMIT 1
0.111 ms 0 /classes/GroupReduction.php:156
212
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8234 LIMIT 1
0.110 ms 1 /classes/Product.php:5655
909
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 43414 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
30
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.110 ms 1 /modules/ps_mbo/ps_mbo.php:325
945
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 49117 AND `id_group` = 1 LIMIT 1
0.110 ms 0 /classes/GroupReduction.php:156
1114
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.109 ms 1 /classes/module/Module.php:2109
474
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 33120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:753
417
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 40670) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:806
82
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8287 LIMIT 1
0.105 ms 1 /classes/Product.php:5655
251
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33119 LIMIT 1
0.104 ms 1 /classes/SpecificPrice.php:435
235
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33117 AND id_shop=1 LIMIT 1
0.104 ms 1 /classes/Product.php:6870
47
SELECT SQL_NO_CACHE ctg.`id_group`
FROM uag_category_group ctg
WHERE ctg.`id_category` = 7902 AND ctg.`id_group` = 1 LIMIT 1
0.103 ms 1 /classes/Category.php:1754
1055
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 43414) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.103 ms 1 /classes/Product.php:7720
37
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.101 ms 1 /classes/Currency.php:893
244
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 33118 AND id_shop=1 LIMIT 1
0.101 ms 1 /classes/Product.php:6870
221
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8234 LIMIT 1
0.101 ms 1 /classes/Product.php:5655
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 40673 AND id_shop=1 LIMIT 1
0.100 ms 1 /classes/Product.php:6870
233
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33117 LIMIT 1
0.100 ms 1 /classes/SpecificPrice.php:435
42
SELECT SQL_NO_CACHE id_shop
FROM `uag_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.100 ms 1 /classes/ObjectModel.php:1729
174
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8218 LIMIT 1
0.100 ms 1 /classes/Product.php:5655
259
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8235 LIMIT 1
0.099 ms 1 /classes/Product.php:5655
260
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 33120 LIMIT 1
0.099 ms 1 /classes/SpecificPrice.php:435
272
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33121 AND `id_group` = 1 LIMIT 1
0.099 ms 0 /classes/GroupReduction.php:156
935
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 49116 AND id_shop=1 LIMIT 1
0.097 ms 1 /classes/Product.php:6870
245
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 33118 AND `id_group` = 1 LIMIT 1
0.096 ms 0 /classes/GroupReduction.php:156
69
SELECT SQL_NO_CACHE format
FROM `uag_address_format`
WHERE `id_country` = 10 LIMIT 1
0.094 ms 1 /classes/AddressFormat.php:656
475
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33120) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.094 ms 1 /classes/stock/StockAvailable.php:806
45
SELECT SQL_NO_CACHE id_shop
FROM `uag_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.092 ms 1 /classes/ObjectModel.php:1729
226
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 40673 AND `id_group` = 1 LIMIT 1
0.088 ms 0 /classes/GroupReduction.php:156
408
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 33116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.088 ms 1 /classes/stock/StockAvailable.php:806
538
COMMIT
0.088 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:100
318
SELECT SQL_NO_CACHE `name` FROM `uag_supplier` WHERE `id_supplier` = 0 LIMIT 1
0.081 ms 0 /classes/Supplier.php:243
70
SELECT SQL_NO_CACHE `need_identification_number`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.076 ms 1 /classes/Country.php:405

Doubles

266 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX))) GROUP BY fp.id_feature_value
52 queries
			SELECT `reduction`
			FROM `uag_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
45 queries
SELECT id_manufacturer FROM `uag_product` WHERE id_product = XX LIMIT XX
45 queries
SELECT *
FROM `uag_product_supplier` aXX
WHERE (aXX.`id_product` = XX)
GROUP BY aXX.`id_supplier`
45 queries
                 SELECT gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "XX-XX-XX XX:XX:XX" OR date_from = "XX-XX-XX XX:XX:XX") AND (date_to >= "XX-XX-XX XX:XX:XX" OR date_to = "XX-XX-XX XX:XX:XX") AND gi.`id_shop` = XX AND gi.`active` = XX  AND (gi.groups = ""  OR FIND_IN_SET(XX, REPLACE(gi.groups, ";", ",")) > XX) AND (gi.manufacturers = "" OR FIND_IN_SET(XX, REPLACE(gi.manufacturers, ";", ",")) > XX) AND (gi.suppliers = "" ) ORDER BY position, priority
38 queries
SELECT XX FROM `uag_specific_price` WHERE id_product = XX LIMIT XX
37 queries
SELECT image_shop.`id_image`
                    FROM `uag_image` i
                     INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
37 queries
SELECT name FROM uag_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
37 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
37 queries
                            SELECT `id_tax_rules_group`
                            FROM `uag_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
37 queries
SELECT SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
37 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `uag_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
37 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM uag_feature_product pf
                LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN uag_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
37 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
37 queries
SELECT *
							FROM `uag_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
37 queries
SELECT product_attribute_shop.id_product_attribute
                FROM uag_product_attribute pa
                 INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT COUNT(p.id_product)
            FROM `uag_product` p
             INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
            WHERE p.id_product = XX
            AND DATEDIFF("XX-XX-XX XX:XX:XX", product_shop.`date_add`) < XX LIMIT XX
24 queries
        SELECT t.`id_lang`, t.`name`
        FROM uag_tag t
        LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
        WHERE pt.`id_product`=XX
24 queries
SELECT out_of_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
17 queries
SELECT `id_module` FROM `uag_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
17 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
15 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `uag_image` i
             INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
15 queries
SELECT `id_product_attribute`
            FROM `uag_product_attribute`
            WHERE `id_product` = XX
15 queries
SELECT DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = XX) AND (pl.id_lang = XX AND pl.id_shop = XX ) LIMIT XX
15 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `uag_iqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
15 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `uag_product_attribute` pa
             INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
15 queries
                SELECT `id_category` FROM `uag_category_product`
                WHERE `id_product` = XX
15 queries
                SELECT fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
                FROM `uag_feature_product` fp
                LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
                WHERE `id_product` = XX
14 queries
			SELECT cl.`link_rewrite`
			FROM `uag_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
13 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
7 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
7 queries
SELECT *
							FROM `uag_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
6 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `uag_module` m
                LEFT JOIN `uag_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
6 queries
				SELECT `name`
				FROM `uag_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
5 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
5 queries
SELECT a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = XX)
WHERE (a.`id_lgcookieslaw_purpose` = XX) AND (a.`id_shop` = XX) AND (a.`active` = XX)
ORDER BY a.`name`
4 queries
				SELECT tr.*
				FROM `uag_tax_rule` tr
				JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = XX
 INNER JOIN uag_supplier_shop supplier_shop
        ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = XX)
WHERE (s.`active` = XX)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
2 queries
SELECT `active`
        FROM `uag_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT m.`id_module` as `active`, ms.`id_module` as `shop_active`
        FROM `uag_module` m
        LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT `id_lang` FROM `uag_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `uag_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `uag_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `uag_country_lang`
							WHERE `id_country` = XX
2 queries
SELECT a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = XX)
WHERE (a.`id_shop` = XX) AND (a.`active` = XX)
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, XX) AS id_product_attribute,
					product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
					pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
					il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
					DATEDIFF(product_shop.`date_add`, DATE_SUB("XX-XX-XX XX:XX:XX",
					INTERVAL XX DAY)) > XX AS new, product_shop.price AS orderprice
				FROM `uag_category_product` cp
				LEFT JOIN `uag_product` p
					ON p.`id_product` = cp.`id_product`
				 INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
				ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = XX AND product_attribute_shop.id_shop=XX)
				 LEFT JOIN uag_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = XX AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
				LEFT JOIN `uag_category_lang` cl
					ON (product_shop.`id_category_default` = cl.`id_category`
					AND cl.`id_lang` = XX AND cl.id_shop = XX )
				LEFT JOIN `uag_product_lang` pl
					ON (p.`id_product` = pl.`id_product`
					AND pl.`id_lang` = XX AND pl.id_shop = XX )
				LEFT JOIN `uag_image_shop` image_shop
					ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=XX AND image_shop.id_shop=XX)
				LEFT JOIN `uag_image_lang` il
					ON (image_shop.`id_image` = il.`id_image`
					AND il.`id_lang` = XX)
				LEFT JOIN `uag_manufacturer` m
					ON m.`id_manufacturer` = p.`id_manufacturer`
				WHERE product_shop.`id_shop` = XX
					AND cp.`id_category` = XX AND product_shop.`active` = XX AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
			LIMIT XX,XX
2 queries
			SELECT `reduction`
			FROM `uag_group`
			WHERE `id_group` = XX LIMIT XX
2 queries
							SELECT `name`
							FROM `uag_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright`  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright` FROM `uag_category` c
            WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.*, cl.*  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
2 queries
DELETE FROM `uag_feedaty_cache` WHERE expiration < XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_widgets" LIMIT XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_analytics" LIMIT XX

Tables stress

865 feature_product
476 product
431 product_shop
390 stock_available
344 product_attribute
307 category
294 category_product
292 product_attribute_combination
279 category_group
274 product_sale
91 product_attribute_shop
82 category_lang
75 cart_product
72 product_lang
54 image_shop
52 image
52 product_group_reduction_cache
46 multipleprices_configuration
45 product_supplier
42 feature_value_lang
39 feature
39 feature_shop
39 feature_lang
38 specific_price
37 pack
36 module
27 module_shop
25 category_shop
24 tag
24 product_tag
20 feature_value
17 image_lang
15 iqitreviews_products
15 attribute
15 attribute_lang
15 attribute_group
9 manufacturer
7 country
7 hook
6 currency
6 feedaty_cache
5 lang
5 country_lang
5 group
5 layered_indexable_feature_value_lang_value
5 lgcookieslaw_cookie
5 lgcookieslaw_cookie_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 tax_rule
4 tax_rules_group
3 country_shop
3 hook_alias
3 supplier
3 group_lang
3 group_shop
3 gmcp_feeds
2 shop_group
2 configuration
2 hook_module
2 supplier_lang
2 supplier_shop
2 currency_lang
2 cart_rule_lang
2 image_type
2 lgcookieslaw_purpose
2 lgcookieslaw_purpose_lang
2 iqit_elementor_category
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 revslider_sliders
1 tax
1 tax_lang
1 gap_refund
1 gap_refund_partial
1 ets_abancart_campaign
1 ets_abancart_campaign_country
1 ets_abancart_campaign_with_lang
1 ets_abancart_campaign_group
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 feature_flag
1 iqit_elementor_category_shop
1 multipleprices_configuration_lang
1 ybc_blog_post
1 ybc_blog_post_shop
1 ybc_blog_post_lang
1 ybc_blog_post_category
1 ybc_blog_post_related_categories
1 customer
1 employee
1 ybc_blog_employee
1 ybc_blog_comment
1 cms
1 cms_lang
1 cms_shop
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Category 160 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 7902]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8217]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8218]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8234]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8235]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8236]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8237]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8238]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8242]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8246]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8248]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8287]
/classes/Meta.php:380 (__construct) [id: 7902]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ganalyticspro/lib/gtag/categoryTag.php:33 (__construct) [id: 7902]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7902]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8287]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8218]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8217]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8234]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8234]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8234]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8234]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8235]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8236]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8236]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8237]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7902]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:64 (__construct) [id: 7902]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:171 (__construct) [id: 7902]
/modules/connettore/connettore.php:490 (__construct) [id: 7902]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 7902]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1338 (__construct) [id: 2]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8235]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8235]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8235]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8234]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8218]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7843]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7902]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 7902]
Product 135 /classes/Link.php:113 (__construct) [id: 33115]
/classes/Link.php:113 (__construct) [id: 40673]
/classes/Link.php:113 (__construct) [id: 33124]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 58200]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33107]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33108]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33109]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33110]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33111]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33112]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33113]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33114]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33115]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33116]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 40670]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 40671]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 40672]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 40673]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33117]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33118]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33119]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33120]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33121]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33122]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 41176]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33123]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 33124]
/classes/Link.php:113 (__construct) [id: 33192]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33115]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33120]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33181]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33184]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33192]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33197]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33205]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 33207]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 43414]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 49114]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 49118]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 49116]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 49117]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 49115]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 68429]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33115]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33115]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33120]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33120]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33181]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33181]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33184]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33184]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33192]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33192]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33197]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33197]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33205]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33205]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33207]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 33207]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 43414]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 43414]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49114]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49114]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49118]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49118]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49116]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49116]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49117]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49117]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49115]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 49115]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 68429]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 68429]
/classes/Link.php:113 (__construct) [id: 33115]
/classes/Link.php:113 (__construct) [id: 33192]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33115]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33120]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33120]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33120]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33120]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33181]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33181]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33181]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33181]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33184]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33184]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33184]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33184]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33192]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33192]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33192]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33192]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33197]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33197]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33197]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33197]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33205]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33205]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33205]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33205]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 33207]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33207]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33207]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 33207]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 43414]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 43414]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 43414]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 43414]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 49114]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49114]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49114]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49114]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 49118]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49118]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49118]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49118]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 49116]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49116]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49116]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49116]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 49117]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49117]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49117]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49117]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 49115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49115]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 49115]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 68429]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68429]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68429]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 68429]
Address 90 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5958 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
Cart 49 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Configuration 47 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 47 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
OrderState 47 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
MultiplepricesConfiguration 15 /modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
Language 6 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/ganalyticspro/lib/gtag/categoryTag.php:52 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:139 (__construct) [id: 1]
Country 6 /config/config.inc.php:146 (__construct) [id: 10]
/classes/controller/FrontController.php:354 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1767 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 19]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:695 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:211 (__construct) [id: 1]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Group 2 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:370 (__construct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 234]
/classes/controller/FrontController.php:1766 (__construct) [id: 234]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
CMS 1 /classes/Link.php:555 (__construct) [id: 3]
AddressFormat 1 /classes/controller/FrontController.php:1761 (generateAddress) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1694 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1691 (__construct) [id: 0]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/ircmaxell/password-compat/lib/password.php
40 /vendor/api-platform/core/src/deprecation.php
41 /vendor/api-platform/core/src/Api/FilterInterface.php
42 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
43 /vendor/api-platform/core/src/deprecated_interfaces.php
44 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
46 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
56 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
58 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
59 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
61 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
62 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
63 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
65 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
66 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
67 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
68 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
69 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
70 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
71 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
72 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
73 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
74 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
75 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
76 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
77 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
78 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
79 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
86 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
90 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
94 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
97 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
98 /vendor/psr/container/src/ContainerInterface.php
99 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /override/classes/Configuration.php
134 /classes/Configuration.php
135 /classes/Validate.php
136 /classes/cache/Cache.php
137 /src/Adapter/EntityMapper.php
138 /classes/db/DbQuery.php
139 /src/Core/Addon/Theme/ThemeManagerBuilder.php
140 /vendor/psr/log/Psr/Log/NullLogger.php
141 /vendor/psr/log/Psr/Log/AbstractLogger.php
142 /vendor/psr/log/Psr/Log/LoggerInterface.php
143 /src/Adapter/Configuration.php
144 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
145 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
146 /src/Core/ConfigurationInterface.php
147 /src/Core/Addon/Theme/ThemeRepository.php
148 /src/Core/Addon/AddonRepositoryInterface.php
149 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
150 /src/Core/Addon/Theme/Theme.php
151 /src/Core/Addon/AddonInterface.php
152 /src/Core/Util/File/YamlParser.php
153 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
154 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
155 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
157 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
158 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
159 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
160 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
161 /var/cache/prod/yaml/84a464d0176e3f6031f8e8ec956aa9cf.php
162 /src/Core/Util/ArrayFinder.php
163 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
164 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
165 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
166 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
167 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
168 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
169 /config/defines_uri.inc.php
170 /classes/Language.php
171 /src/Core/Language/LanguageInterface.php
172 /classes/Country.php
173 /classes/PrestaShopCollection.php
174 /classes/shop/ShopGroup.php
175 /classes/Cookie.php
176 /classes/PhpEncryption.php
177 /classes/PhpEncryptionEngine.php
178 /vendor/defuse/php-encryption/src/Key.php
179 /vendor/defuse/php-encryption/src/Encoding.php
180 /vendor/defuse/php-encryption/src/Core.php
181 /src/Core/Session/SessionHandler.php
182 /src/Core/Session/SessionHandlerInterface.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
197 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
198 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
199 /config/smarty.config.inc.php
200 /vendor/smarty/smarty/libs/Smarty.class.php
201 /vendor/smarty/smarty/libs/functions.php
202 /vendor/smarty/smarty/libs/Autoloader.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
212 /config/smartyfront.config.inc.php
213 /classes/Smarty/SmartyResourceModule.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
215 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
216 /classes/Smarty/SmartyResourceParent.php
217 /classes/Smarty/SmartyLazyRegister.php
218 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
219 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
220 /classes/Customer.php
221 /classes/Group.php
222 /override/classes/Link.php
223 /classes/Link.php
224 /classes/shop/ShopUrl.php
225 /override/classes/Dispatcher.php
226 /classes/Dispatcher.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
232 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
233 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
234 /src/Adapter/SymfonyContainer.php
235 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
236 /config/db_slave_server.inc.php
237 /modules/doofinder/doofinder.php
238 /modules/doofinder/lib/dfTools.class.php
239 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
241 /classes/Translate.php
242 /modules/doofinder/translations/it.php
243 /src/PrestaShopBundle/Translation/TranslatorComponent.php
244 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
246 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
247 /vendor/symfony/contracts/Translation/TranslatorInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
249 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
250 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
258 /vendor/symfony/contracts/Translation/TranslatorTrait.php
259 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
261 /var/cache/prod/translations/catalogue.it-IT.NXhscRe.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
264 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
265 /modules/ybc_blog/ybc_blog.php
266 /modules/ybc_blog/classes/ybc_blog_category_class.php
267 /modules/ybc_blog/classes/ybc_blog_post_class.php
268 /modules/ybc_blog/classes/ybc_blog_paggination_class.php
269 /modules/ybc_blog/classes/ybc_blog_comment_class.php
270 /modules/ybc_blog/classes/ybc_blog_reply_class.php
271 /modules/ybc_blog/classes/ybc_blog_polls_class.php
272 /modules/ybc_blog/classes/ybc_blog_slide_class.php
273 /modules/ybc_blog/classes/ybc_blog_gallery_class.php
274 /modules/ybc_blog/classes/ybc_blog_link_class.php
275 /modules/ybc_blog/classes/ybc_blog_employee_class.php
276 /modules/ybc_blog/classes/ybc_blog_email_template_class.php
277 /modules/ybc_blog/classes/ImportExport.php
278 /modules/ybc_blog/classes/ybc_browser.php
279 /modules/ybc_blog/ybc_blog_defines.php
280 /modules/ybc_blog/classes/ybc_chatgpt.php
281 /modules/ybc_blog/classes/ybc_chatgpt_message.php
282 /modules/ybc_blog/src/FormType/DescriptionType.php
283 /src/PrestaShopBundle/Form/Admin/Sell/Product/Description/DescriptionType.php
284 /src/PrestaShopBundle/Form/Admin/Type/TranslatorAwareType.php
285 /src/PrestaShopBundle/Form/Admin/Type/CommonAbstractType.php
286 /vendor/symfony/symfony/src/Symfony/Component/Form/AbstractType.php
287 /vendor/symfony/symfony/src/Symfony/Component/Form/FormTypeInterface.php
288 /modules/ybc_blog/translations/it.php
289 /modules/simpleimportproduct/simpleimportproduct.php
290 /modules/simpleimportproduct/classes/mpmTools.php
291 /modules/simpleimportproduct/translations/it.php
292 /classes/Supplier.php
293 /override/classes/Feature.php
294 /classes/Feature.php
295 /modules/ets_abandonedcart/ets_abandonedcart.php
296 /modules/ets_abandonedcart/classes/EtsAbancartCore.php
297 /modules/ets_abandonedcart/classes/EtsAbancartCache.php
298 /modules/ets_abandonedcart/classes/EtsAbancartValidate.php
299 /modules/ets_abandonedcart/classes/EtsAbancartTools.php
300 /modules/ets_abandonedcart/classes/EtsAbancartMail.php
301 /classes/Mail.php
302 /modules/ets_abandonedcart/classes/EtsAbancartIndex.php
303 /modules/ets_abandonedcart/classes/EtsAbancartIndexCustomer.php
304 /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php
305 /modules/ets_abandonedcart/classes/EtsAbancartReminder.php
306 /modules/ets_abandonedcart/classes/EtsAbancartEmailTemplate.php
307 /modules/ets_abandonedcart/classes/EtsAbancartTracking.php
308 /modules/ets_abandonedcart/classes/EtsAbancartDisplayTracking.php
309 /modules/ets_abandonedcart/classes/EtsAbancartReminderForm.php
310 /modules/ets_abandonedcart/classes/EtsAbancartQueue.php
311 /modules/ets_abandonedcart/classes/EtsAbancartShoppingCart.php
312 /modules/ets_abandonedcart/classes/EtsAbancartUnsubscribers.php
313 /modules/ets_abandonedcart/classes/EtsAbancartDefines.php
314 /modules/ets_abandonedcart/classes/EtsAbancartForm.php
315 /modules/ets_abandonedcart/classes/EtsAbancartFormSubmit.php
316 /modules/ets_abandonedcart/classes/EtsAbancartField.php
317 /modules/ets_abandonedcart/classes/EtsAbancartFieldValue.php
318 /modules/ets_abandonedcart/translations/it.php
319 /modules/ps_mbo/ps_mbo.php
320 /modules/ps_mbo/vendor/autoload.php
321 /modules/ps_mbo/vendor/composer/autoload_real.php
322 /modules/ps_mbo/vendor/composer/platform_check.php
323 /modules/ps_mbo/vendor/composer/autoload_static.php
324 /modules/ps_mbo/vendor/clue/stream-filter/src/functions_include.php
325 /modules/ps_mbo/vendor/clue/stream-filter/src/functions.php
326 /modules/ps_mbo/vendor/php-http/message/src/filters.php
327 /modules/ps_mbo/vendor/sentry/sentry/src/functions.php
328 /modules/ps_mbo/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
329 /modules/ps_mbo/vendor/symfony/string/Resources/functions.php
330 /modules/ps_mbo/bootstrap.php
331 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
332 /modules/ps_mbo/src/Traits/HaveTabs.php
333 /modules/ps_mbo/src/Traits/UseHooks.php
334 /modules/ps_mbo/src/Traits/Hooks/UseDisplayBackOfficeEmployeeMenu.php
335 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneOne.php
336 /modules/ps_mbo/src/Traits/HaveCdcComponent.php
337 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneTwo.php
338 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneThree.php
339 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminThemesListAfter.php
340 /modules/ps_mbo/src/Traits/Hooks/UseDisplayDashboardTop.php
341 /modules/ps_mbo/src/Traits/Hooks/UseActionAdminControllerSetMedia.php
342 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeInstallModule.php
343 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAdminToolbarButtons.php
344 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAlternativeSearchPanels.php
345 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminAfterHeader.php
346 /modules/ps_mbo/src/Traits/Hooks/UseDisplayModuleConfigureExtraButtons.php
347 /modules/ps_mbo/src/Traits/Hooks/UseActionListModules.php
348 /modules/ps_mbo/src/Traits/Hooks/UseActionModuleRegisterHookAfter.php
349 /modules/ps_mbo/src/Traits/Hooks/UseDisplayEmptyModuleCategoryExtraMessage.php
350 /modules/ps_mbo/src/Traits/Hooks/UseActionDispatcherBefore.php
351 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectShopUrlUpdateAfter.php
352 /modules/ps_mbo/src/Traits/Hooks/UseActionGeneralPageSave.php
353 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeUpgradeModule.php
354 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeDeleteBefore.php
355 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeUpdateBefore.php
356 /modules/ps_mbo/src/Traits/HaveShopOnExternalService.php
357 /modules/ps_mbo/src/Tab/TabInterface.php
358 /src/PrestaShopBundle/Translation/DomainNormalizer.php
359 /src/Adapter/Localization/LegacyTranslator.php
360 /modules/ps_mbo/vendor/symfony/string/UnicodeString.php
361 /modules/ps_mbo/vendor/symfony/string/AbstractUnicodeString.php
362 /modules/ps_mbo/vendor/symfony/string/AbstractString.php
363 /controllers/front/listing/CategoryController.php
364 /classes/controller/ProductListingFrontController.php
365 /classes/controller/ProductPresentingFrontController.php
366 /classes/controller/FrontController.php
367 /src/Adapter/Presenter/Object/ObjectPresenter.php
368 /src/Adapter/Presenter/PresenterInterface.php
369 /src/Adapter/Presenter/Cart/CartPresenter.php
370 /src/Adapter/Product/PriceFormatter.php
371 /src/Adapter/Image/ImageRetriever.php
372 /classes/tax/TaxConfiguration.php
373 /classes/Smarty/TemplateFinder.php
374 /classes/assets/StylesheetManager.php
375 /classes/assets/AbstractAssetManager.php
376 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
377 /classes/assets/JavascriptManager.php
378 /classes/assets/CccReducer.php
379 /modules/iqitthemeeditor/iqitthemeeditor.php
380 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
381 /modules/iqitthemeeditor/translations/it.php
382 /override/classes/Category.php
383 /classes/Category.php
384 /classes/webservice/WebserviceRequest.php
385 /src/Adapter/ContainerBuilder.php
386 /src/Adapter/Environment.php
387 /src/Core/EnvironmentInterface.php
388 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
389 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
390 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
391 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
392 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
393 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
394 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
395 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
396 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
397 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
398 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
399 /vendor/symfony/contracts/Service/ResetInterface.php
400 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
401 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
402 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
403 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
404 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
405 /vendor/symfony/contracts/Cache/ItemInterface.php
406 /vendor/psr/cache/src/CacheItemInterface.php
407 /vendor/psr/cache/src/CacheItemPoolInterface.php
408 /vendor/symfony/contracts/Cache/CacheInterface.php
409 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
410 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
411 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
412 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
413 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
414 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
415 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
416 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
417 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
418 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
419 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
420 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
421 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
422 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
423 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
424 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
425 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
426 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
427 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
428 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
429 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
430 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
431 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
432 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
433 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
434 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
435 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
436 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
437 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
438 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
439 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
440 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
441 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
442 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
443 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
444 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
445 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
446 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
447 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
448 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
449 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
450 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
451 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
452 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
453 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
454 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
455 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
456 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
457 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
458 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
459 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
460 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
461 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
462 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
463 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
464 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
465 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
466 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
467 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
468 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
469 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
470 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
471 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
472 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
473 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
474 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
475 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
476 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
477 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
478 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
479 /var/cache/prod/FrontContainer.php
480 /src/Adapter/Container/LegacyContainer.php
481 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
482 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
483 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
484 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
485 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
486 /vendor/psr/container/src/ContainerExceptionInterface.php
487 /vendor/psr/container/src/NotFoundExceptionInterface.php
488 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
489 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
490 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
491 /src/Adapter/Container/LegacyContainerInterface.php
492 /modules/ps_shoppingcart/vendor/autoload.php
493 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
494 /modules/ps_shoppingcart/vendor/composer/platform_check.php
495 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
496 /modules/ps_emailsubscription/vendor/autoload.php
497 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
498 /modules/ps_emailsubscription/vendor/composer/platform_check.php
499 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
500 /modules/productcomments/vendor/autoload.php
501 /modules/productcomments/vendor/composer/autoload_real.php
502 /modules/productcomments/vendor/composer/platform_check.php
503 /modules/productcomments/vendor/composer/autoload_static.php
504 /modules/ps_facetedsearch/vendor/autoload.php
505 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
506 /modules/ps_facetedsearch/vendor/composer/platform_check.php
507 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
508 /modules/contactform/vendor/autoload.php
509 /modules/contactform/vendor/composer/autoload_real.php
510 /modules/contactform/vendor/composer/platform_check.php
511 /modules/contactform/vendor/composer/autoload_static.php
512 /modules/ps_emailalerts/vendor/autoload.php
513 /modules/ps_emailalerts/vendor/composer/autoload_real.php
514 /modules/ps_emailalerts/vendor/composer/platform_check.php
515 /modules/ps_emailalerts/vendor/composer/autoload_static.php
516 /modules/ps_checkpayment/vendor/autoload.php
517 /modules/ps_checkpayment/vendor/composer/autoload_real.php
518 /modules/ps_checkpayment/vendor/composer/platform_check.php
519 /modules/ps_checkpayment/vendor/composer/autoload_static.php
520 /modules/ps_wirepayment/vendor/autoload.php
521 /modules/ps_wirepayment/vendor/composer/autoload_real.php
522 /modules/ps_wirepayment/vendor/composer/platform_check.php
523 /modules/ps_wirepayment/vendor/composer/autoload_static.php
524 /modules/statscheckup/vendor/autoload.php
525 /modules/statscheckup/vendor/composer/autoload_real.php
526 /modules/statscheckup/vendor/composer/platform_check.php
527 /modules/statscheckup/vendor/composer/autoload_static.php
528 /modules/statscatalog/vendor/autoload.php
529 /modules/statscatalog/vendor/composer/autoload_real.php
530 /modules/statscatalog/vendor/composer/platform_check.php
531 /modules/statscatalog/vendor/composer/autoload_static.php
532 /modules/dashactivity/vendor/autoload.php
533 /modules/dashactivity/vendor/composer/autoload_real.php
534 /modules/dashactivity/vendor/composer/platform_check.php
535 /modules/dashactivity/vendor/composer/autoload_static.php
536 /modules/dashproducts/vendor/autoload.php
537 /modules/dashproducts/vendor/composer/autoload_real.php
538 /modules/dashproducts/vendor/composer/platform_check.php
539 /modules/dashproducts/vendor/composer/autoload_static.php
540 /modules/dashtrends/vendor/autoload.php
541 /modules/dashtrends/vendor/composer/autoload_real.php
542 /modules/dashtrends/vendor/composer/platform_check.php
543 /modules/dashtrends/vendor/composer/autoload_static.php
544 /modules/ps_distributionapiclient/vendor/autoload.php
545 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
546 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
547 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
548 /modules/pagesnotfound/vendor/autoload.php
549 /modules/pagesnotfound/vendor/composer/autoload_real.php
550 /modules/pagesnotfound/vendor/composer/platform_check.php
551 /modules/pagesnotfound/vendor/composer/autoload_static.php
552 /modules/statsproduct/vendor/autoload.php
553 /modules/statsproduct/vendor/composer/autoload_real.php
554 /modules/statsproduct/vendor/composer/platform_check.php
555 /modules/statsproduct/vendor/composer/autoload_static.php
556 /modules/ps_themecusto/vendor/autoload.php
557 /modules/ps_themecusto/vendor/composer/autoload_real.php
558 /modules/ps_themecusto/vendor/composer/platform_check.php
559 /modules/ps_themecusto/vendor/composer/autoload_static.php
560 /modules/ps_checkout/vendor/autoload.php
561 /modules/ps_checkout/vendor/composer/autoload_real.php
562 /modules/ps_checkout/vendor/composer/platform_check.php
563 /modules/ps_checkout/vendor/composer/autoload_static.php
564 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
565 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment.php
566 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Client.php
567 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
568 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
569 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
570 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
571 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
572 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
573 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Version.php
574 /modules/ps_accounts/vendor/autoload.php
575 /modules/ps_accounts/vendor/composer/autoload_real.php
576 /modules/ps_accounts/vendor/composer/platform_check.php
577 /modules/ps_accounts/vendor/composer/autoload_static.php
578 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
579 /modules/ps_accounts/vendor/symfony/polyfill-php70/bootstrap.php
580 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions_include.php
581 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions.php
582 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions_include.php
583 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions.php
584 /modules/ps_accounts/vendor/symfony/polyfill-apcu/bootstrap.php
585 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions_include.php
586 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions.php
587 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
588 /modules/gmerchantcenterpro/vendor/autoload.php
589 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
590 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
591 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
592 /modules/ganalyticspro/vendor/autoload.php
593 /modules/ganalyticspro/vendor/composer/autoload_real.php
594 /modules/ganalyticspro/vendor/composer/platform_check.php
595 /modules/ganalyticspro/vendor/composer/autoload_static.php
596 /modules/fattura24/vendor/autoload.php
597 /modules/fattura24/vendor/composer/autoload_real.php
598 /modules/fattura24/vendor/composer/autoload_static.php
599 /modules/payplug/vendor/autoload.php
600 /modules/payplug/vendor/composer/autoload_real.php
601 /modules/payplug/vendor/composer/autoload_static.php
602 /modules/sendinblue/vendor/autoload.php
603 /modules/sendinblue/vendor/composer/autoload_real.php
604 /modules/sendinblue/vendor/composer/platform_check.php
605 /modules/sendinblue/vendor/composer/autoload_static.php
606 /modules/gremarketing/vendor/autoload.php
607 /modules/gremarketing/vendor/composer/autoload_real.php
608 /modules/gremarketing/vendor/composer/platform_check.php
609 /modules/gremarketing/vendor/composer/autoload_static.php
610 /modules/feedaty/vendor/autoload.php
611 /modules/feedaty/vendor/composer/autoload_real.php
612 /modules/feedaty/vendor/composer/autoload_static.php
613 /modules/seoimg/vendor/autoload.php
614 /modules/seoimg/vendor/composer/autoload_real.php
615 /modules/seoimg/vendor/composer/platform_check.php
616 /modules/seoimg/vendor/composer/autoload_static.php
617 /modules/psrecaptcha/vendor/autoload.php
618 /modules/psrecaptcha/vendor/composer/autoload_real.php
619 /modules/psrecaptcha/vendor/composer/platform_check.php
620 /modules/psrecaptcha/vendor/composer/autoload_static.php
621 /modules/autoupgrade/vendor/autoload.php
622 /modules/autoupgrade/vendor/composer/autoload_real.php
623 /modules/autoupgrade/vendor/composer/autoload_static.php
624 /modules/lgcookieslaw/vendor/autoload.php
625 /modules/lgcookieslaw/vendor/composer/autoload_real.php
626 /modules/lgcookieslaw/vendor/composer/autoload_static.php
627 /src/Core/Localization/Locale/Repository.php
628 /src/Core/Localization/Locale/RepositoryInterface.php
629 /src/Core/Localization/CLDR/LocaleRepository.php
630 /src/Core/Localization/CLDR/LocaleDataSource.php
631 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
632 /src/Core/Data/Layer/AbstractDataLayer.php
633 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
634 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
635 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
636 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
639 /vendor/symfony/contracts/Cache/CacheTrait.php
640 /vendor/psr/cache/src/InvalidArgumentException.php
641 /vendor/psr/cache/src/CacheException.php
642 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
643 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
644 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
645 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
646 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
647 /src/Core/Localization/CLDR/Reader.php
648 /src/Core/Localization/CLDR/ReaderInterface.php
649 /src/Core/Localization/Currency/Repository.php
650 /src/Core/Localization/Currency/RepositoryInterface.php
651 /src/Core/Localization/Currency/CurrencyDataSource.php
652 /src/Core/Localization/Currency/DataSourceInterface.php
653 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
654 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
655 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
656 /src/Adapter/Currency/CurrencyDataProvider.php
657 /src/Core/Currency/CurrencyDataProviderInterface.php
658 /src/Adapter/LegacyContext.php
659 /src/Adapter/Tools.php
660 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
661 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
662 /vendor/prestashop/decimal/src/Operation/Rounding.php
663 /src/Core/Localization/Locale.php
664 /src/Core/Localization/LocaleInterface.php
665 /src/Core/Localization/Specification/Price.php
666 /src/Core/Localization/Specification/Number.php
667 /src/Core/Localization/Specification/NumberInterface.php
668 /src/Core/Localization/Specification/Factory.php
669 /src/Core/Localization/CLDR/LocaleData.php
670 /src/Core/Localization/CLDR/NumberSymbolsData.php
671 /src/Core/Localization/CLDR/CurrencyData.php
672 /src/Core/Localization/CLDR/Locale.php
673 /src/Core/Localization/CLDR/LocaleInterface.php
674 /src/Core/Localization/Specification/NumberSymbolList.php
675 /classes/Currency.php
676 /src/Core/Localization/Currency/LocalizedCurrencyId.php
677 /src/Core/Localization/Currency/CurrencyData.php
678 /src/Core/Localization/Currency/CurrencyCollection.php
679 /src/Core/Localization/Currency.php
680 /src/Core/Localization/CurrencyInterface.php
681 /src/Core/Localization/Specification/NumberCollection.php
682 /src/Core/Localization/Number/Formatter.php
683 /classes/Cart.php
684 /src/Adapter/AddressFactory.php
685 /classes/CartRule.php
686 /override/classes/Product.php
687 /classes/Product.php
688 /src/Core/Domain/Product/ValueObject/RedirectType.php
689 /src/Core/Util/DateTime/DateTime.php
690 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
691 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
692 /src/Core/Domain/Product/ValueObject/ProductType.php
693 /src/Core/Domain/Product/ValueObject/Reference.php
694 /src/Core/Domain/Product/ValueObject/Ean13.php
695 /src/Core/Domain/Product/ValueObject/Isbn.php
696 /src/Core/Domain/Product/ValueObject/Upc.php
697 /src/Core/Domain/Product/ProductSettings.php
698 /src/Core/Domain/Shop/ValueObject/ShopId.php
699 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
700 /modules/ps_emailsubscription/ps_emailsubscription.php
701 /src/Core/Module/WidgetInterface.php
702 /classes/Media.php
703 /modules/ps_emailalerts/ps_emailalerts.php
704 /modules/ps_emailalerts/MailAlert.php
705 /modules/ps_checkout/ps_checkout.php
706 /classes/PaymentModule.php
707 /modules/ps_checkout/translations/it.php
708 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
709 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
710 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
711 /var/cache/prod/Ps_checkout8400FrontContainer.php
712 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
713 /modules/ps_checkout/src/Validator/MerchantValidator.php
714 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
715 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
716 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
717 /modules/ps_checkout/src/Shop/ShopProvider.php
718 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
719 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
720 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
721 /modules/ps_checkout/src/Repository/PsAccountRepository.php
722 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
723 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
724 /src/Core/Addon/Module/ModuleManagerBuilder.php
725 /var/cache/prod/yaml/1deb99a1745c58282b5926d8d607faaa.php
726 /src/Adapter/LegacyLogger.php
727 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
728 /src/Adapter/Module/ModuleDataProvider.php
729 /src/Adapter/Module/AdminModuleDataProvider.php
730 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
731 /src/Adapter/Module/Module.php
732 /src/Core/Module/ModuleInterface.php
733 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
734 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
735 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
736 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
737 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
738 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
739 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
740 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
741 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
742 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
743 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
744 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
745 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
746 /src/Adapter/Module/ModuleDataUpdater.php
747 /src/Core/Module/ModuleManager.php
748 /src/Core/Module/ModuleManagerInterface.php
749 /src/Core/Module/ModuleRepository.php
750 /src/Core/Module/ModuleRepositoryInterface.php
751 /src/Adapter/HookManager.php
752 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
753 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
754 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
755 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
756 /modules/ps_distributionapiclient/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
757 /src/Core/Hook/HookDispatcherInterface.php
758 /modules/ps_accounts/ps_accounts.php
759 /modules/ps_accounts/src/Hook/HookableTrait.php
760 /modules/ps_accounts/src/Module/Install.php
761 /modules/ps_accounts/translations/it.php
762 /modules/ps_accounts/src/DependencyInjection/ServiceContainer.php
763 /modules/ps_accounts/src/DependencyInjection/ContainerProvider.php
764 /var/cache/prod/Ps_accounts701FrontContainer.php
765 /modules/ps_accounts/src/Service/PsAccountsService.php
766 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
767 /modules/ps_accounts/src/Account/Session/Session.php
768 /modules/ps_accounts/src/Account/Session/SessionInterface.php
769 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
770 /modules/ps_accounts/src/Adapter/Configuration.php
771 /modules/ps_accounts/src/Account/Session/ShopSession.php
772 /modules/ps_accounts/src/Account/Session/RefreshFirebaseTokens.php
773 /modules/ps_accounts/src/Provider/OAuth2/ShopProvider.php
774 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/PrestaShop.php
775 /modules/ps_accounts/vendor/league/oauth2-client/src/Provider/AbstractProvider.php
776 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/ArrayAccessorTrait.php
777 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/GuardedPropertyTrait.php
778 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/QueryBuilderTrait.php
779 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/BearerAuthorizationTrait.php
780 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/LogoutTrait.php
781 /modules/ps_accounts/src/Provider/OAuth2/Oauth2Client.php
782 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
783 /modules/ps_accounts/src/Type/Enum.php
784 /modules/ps_accounts/src/Adapter/Link.php
785 /modules/ps_accounts/src/Context/ShopContext.php
786 /modules/ps_accounts/vendor/league/oauth2-client/src/Grant/GrantFactory.php
787 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/RequestFactory.php
788 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Client.php
789 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/ClientInterface.php
790 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/HandlerStack.php
791 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/Proxy.php
792 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlMultiHandler.php
793 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactory.php
794 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactoryInterface.php
795 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlHandler.php
796 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/StreamHandler.php
797 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Middleware.php
798 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/RedirectMiddleware.php
799 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/PostAuthOptionProvider.php
800 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/OptionProviderInterface.php
801 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
802 /modules/ps_accounts/src/Account/LinkShop.php
803 /modules/ps_checkout/src/Context/PrestaShopContext.php
804 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
805 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
806 /modules/ps_checkout/src/Version/Version.php
807 /modules/psrecaptcha/psrecaptcha.php
808 /modules/psrecaptcha/translations/it.php
809 /classes/ProductDownload.php
810 /classes/tax/Tax.php
811 /src/Core/Localization/CLDR/ComputingPrecision.php
812 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
813 /src/Core/Cart/Calculator.php
814 /src/Core/Cart/CartRowCollection.php
815 /src/Core/Cart/Fees.php
816 /src/Core/Cart/AmountImmutable.php
817 /src/Core/Cart/CartRuleCollection.php
818 /src/Core/Cart/CartRuleCalculator.php
819 /src/Adapter/Product/PriceCalculator.php
820 /classes/order/Order.php
821 /src/Core/Cart/CartRow.php
822 /vendor/prestashop/decimal/src/DecimalNumber.php
823 /vendor/prestashop/decimal/src/Builder.php
824 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
825 /classes/Gender.php
826 /classes/Risk.php
827 /classes/Meta.php
828 /modules/revsliderprestashop/revsliderprestashop.php
829 /modules/revsliderprestashop/rev-loader.php
830 /modules/revsliderprestashop/includes/revslider_db.class.php
831 /modules/revsliderprestashop/includes/data.class.php
832 /modules/revsliderprestashop/includes/functions.class.php
833 /modules/revsliderprestashop/includes/em-integration.class.php
834 /modules/revsliderprestashop/includes/cssparser.class.php
835 /modules/revsliderprestashop/includes/woocommerce.class.php
836 /modules/revsliderprestashop/includes/wpml.class.php
837 /modules/revsliderprestashop/includes/colorpicker.class.php
838 /modules/revsliderprestashop/includes/navigation.class.php
839 /modules/revsliderprestashop/includes/object-library.class.php
840 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
841 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
842 /modules/revsliderprestashop/includes/extension.class.php
843 /modules/revsliderprestashop/includes/favorite.class.php
844 /modules/revsliderprestashop/includes/aq-resizer.class.php
845 /modules/revsliderprestashop/includes/external-sources.class.php
846 /modules/revsliderprestashop/includes/page-template.class.php
847 /modules/revsliderprestashop/includes/slider.class.php
848 /modules/revsliderprestashop/includes/slide.class.php
849 /modules/revsliderprestashop/includes/output.class.php
850 /modules/revsliderprestashop/public/revslider-front.class.php
851 /modules/revsliderprestashop/includes/backwards.php
852 /modules/revsliderprestashop/admin/includes/class-pclzip.php
853 /modules/revsliderprestashop/admin/includes/license.class.php
854 /modules/revsliderprestashop/admin/includes/addons.class.php
855 /modules/revsliderprestashop/admin/includes/template.class.php
856 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
857 /modules/revsliderprestashop/admin/includes/folder.class.php
858 /modules/revsliderprestashop/admin/includes/import.class.php
859 /modules/revsliderprestashop/admin/includes/export.class.php
860 /modules/revsliderprestashop/admin/includes/export-html.class.php
861 /modules/revsliderprestashop/admin/includes/newsletter.class.php
862 /modules/revsliderprestashop/admin/revslider-admin.class.php
863 /modules/revsliderprestashop/includes/update.class.php
864 /modules/revsliderprestashop/includes/resize-imag.php
865 /modules/revsliderprestashop/translations/it.php
866 /override/classes/Address.php
867 /classes/Address.php
868 /modules/arteinvoice/arteinvoice.php
869 /modules/arteinvoice/translations/it.php
870 /classes/ImageType.php
871 /classes/State.php
872 /src/Core/Security/PasswordPolicyConfiguration.php
873 /src/Core/Configuration/DataConfigurationInterface.php
874 /src/Core/Security/Hashing.php
875 /src/Core/Filter/FrontEndObject/MainFilter.php
876 /src/Core/Filter/FilterInterface.php
877 /src/Core/Filter/FrontEndObject/CartFilter.php
878 /src/Core/Filter/HashMapWhitelistFilter.php
879 /src/Core/Filter/CollectionFilter.php
880 /src/Core/Filter/FrontEndObject/ProductFilter.php
881 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
882 /src/Core/Filter/FrontEndObject/CustomerFilter.php
883 /src/Core/Filter/FrontEndObject/ShopFilter.php
884 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
885 /modules/lgcookieslaw/lgcookieslaw.php
886 /modules/lgcookieslaw/config/config.inc.php
887 /modules/lgcookieslaw/translations/it.php
888 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php
889 /vendor/defuse/php-encryption/src/Crypto.php
890 /vendor/defuse/php-encryption/src/KeyOrPassword.php
891 /vendor/defuse/php-encryption/src/RuntimeTests.php
892 /vendor/defuse/php-encryption/src/DerivedKeys.php
893 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
894 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
895 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
896 /var/cache/prod/smarty/compile/37/43/2c/37432c861bff16f5b2f4e73e17290a859706693a_2.file.view_cookies_scripts_content.tpl.php
897 /var/cache/prod/smarty/compile/19/c5/80/19c58092aad1b9d2c0faefe208b7555546f1a69f_2.file.view_header.tpl.php
898 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
899 /modules/ps_shoppingcart/ps_shoppingcart.php
900 /modules/productcomments/productcomments.php
901 /modules/iqitcompare/iqitcompare.php
902 /modules/iqitcompare/translations/it.php
903 /modules/iqitcontactpage/iqitcontactpage.php
904 /modules/iqitcontactpage/translations/it.php
905 /modules/iqitcountdown/iqitcountdown.php
906 /modules/iqitcountdown/translations/it.php
907 /modules/iqitelementor/iqitelementor.php
908 /modules/iqitelementor/src/IqitElementorLanding.php
909 /modules/iqitelementor/src/IqitElementorTemplate.php
910 /modules/iqitelementor/src/IqitElementorProduct.php
911 /modules/iqitelementor/src/IqitElementorCategory.php
912 /modules/iqitelementor/src/IqitElementorContent.php
913 /modules/iqitelementor/src/iqitElementorWpHelper.php
914 /modules/iqitelementor/includes/plugin-elementor.php
915 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
916 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
917 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
918 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
919 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
920 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
921 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
922 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
923 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
924 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
925 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
926 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
927 /modules/iqitelementor/translations/it.php
928 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
929 /modules/iqitfreedeliverycount/translations/it.php
930 /modules/iqitmegamenu/iqitmegamenu.php
931 /modules/iqitmegamenu/models/IqitMenuTab.php
932 /modules/iqitmegamenu/models/IqitMenuHtml.php
933 /modules/iqitmegamenu/models/IqitMenuLinks.php
934 /modules/iqitmegamenu/translations/it.php
935 /modules/iqitreviews/iqitreviews.php
936 /modules/iqitreviews/src/IqitProductReview.php
937 /modules/iqitwishlist/iqitwishlist.php
938 /modules/iqitwishlist/src/IqitWishlistProduct.php
939 /modules/iqitwishlist/translations/it.php
940 /modules/iqitextendedproduct/iqitextendedproduct.php
941 /modules/iqitextendedproduct/src/IqitThreeSixty.php
942 /modules/iqitextendedproduct/src/IqitProductVideo.php
943 /modules/iqitextendedproduct/translations/it.php
944 /modules/artproduttori/artproduttori.php
945 /modules/artproduttori/translations/it.php
946 /var/cache/prod/smarty/compile/shopwarehouse/2a/78/bf/2a78bfe324326a3e5b719fcedc43fa2217413e51_2.file.scriptV9.tpl.php
947 /modules/ganalyticspro/ganalyticspro.php
948 /modules/ganalyticspro/translations/it.php
949 /modules/ganalyticspro/lib/moduleTools.php
950 /modules/ganalyticspro/conf/moduleConfiguration.php
951 /modules/ganalyticspro/lib/hook/hookController.php
952 /modules/ganalyticspro/lib/hook/hookDisplay.php
953 /modules/ganalyticspro/lib/hook/hookInterface.php
954 /modules/ganalyticspro/lib/gtag/baseTag.php
955 /modules/ganalyticspro/lib/gtag/categoryTag.php
956 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
957 /classes/Combination.php
958 /classes/stock/StockAvailable.php
959 /classes/SpecificPrice.php
960 /classes/tax/TaxManagerFactory.php
961 /classes/tax/TaxRulesTaxManager.php
962 /classes/tax/TaxManagerInterface.php
963 /classes/tax/TaxCalculator.php
964 /classes/GroupReduction.php
965 /classes/Pack.php
966 /override/classes/Manufacturer.php
967 /classes/Manufacturer.php
968 /classes/Tag.php
969 /modules/ganalyticspro/models/orderRefund.php
970 /modules/ganalyticspro/models/orderPartialRefund.php
971 /var/cache/prod/smarty/compile/shopwarehouse/1c/84/58/1c8458cc9d4e9ed9c19ec87cbfcb12174e2707f9_2.file.header.tpl.php
972 /var/cache/prod/smarty/compile/shopwarehouse/b4/00/ef/b400eff9187b1d53d67faeda1e6035db24007b26_2.file.apichatgpt.tpl.php
973 /var/cache/prod/smarty/compile/shopwarehouse/67/1c/ce/671ccec8ce19597b0b74aa75c89c3e503b4f00be_2.file.head.tpl.php
974 /modules/shinystat/shinystat.php
975 /modules/shinystat/translations/it.php
976 /modules/ets_integrategooglemarketing/ets_integrategooglemarketing.php
977 /modules/ets_integrategooglemarketing/classes/Ets_integrategooglemarketing_defines.php
978 /modules/ets_integrategooglemarketing/translations/it.php
979 /var/cache/prod/smarty/compile/shopwarehouse/a5/b7/a4/a5b7a45ca285fcbfe2b88dceb9824ebefab6b6ac_2.file.google_tag_head.tpl.php
980 /var/cache/prod/smarty/compile/shopwarehouse/ce/33/81/ce33814f2d98ddedf15ce7084df0cb6273514cb7_2.file.google_search_console.tpl.php
981 /modules/cdc_googletagmanager/cdc_googletagmanager.php
982 /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php
983 /modules/cdc_googletagmanager/services/CdcTools.php
984 /modules/cdc_googletagmanager/services/PrestashopUtils.php
985 /modules/cdc_googletagmanager/classes/DataLayer.php
986 /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php
987 /modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php
988 /modules/cdc_googletagmanager/services/Gtm_Product.php
989 /modules/cdc_googletagmanager/classes/gtm/Refund.php
990 /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php
991 /modules/cdc_googletagmanager/classes/gtm_ga4/DataLayerItem.php
992 /modules/cdc_googletagmanager/translations/it.php
993 /modules/gremarketing/gremarketing.php
994 /modules/gremarketing/lib/moduleTools.php
995 /modules/gremarketing/translations/it.php
996 /modules/gremarketing/conf/moduleConfiguration.php
997 /modules/gremarketing/lib/hook/hookController.php
998 /modules/gremarketing/lib/hook/hookDisplay.php
999 /modules/gremarketing/lib/hook/hookBase.php
1000 /modules/gmerchantcenterpro/gmerchantcenterpro.php
1001 /modules/gmerchantcenterpro/translations/it.php
1002 /modules/gmerchantcenterpro/lib/moduleTools.php
1003 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
1004 /modules/gmerchantcenterpro/lib/moduleUpdate.php
1005 /modules/gmerchantcenterpro/lib/install/installController.php
1006 /modules/gmerchantcenterpro/lib/install/installSql.php
1007 /modules/gmerchantcenterpro/lib/install/installInterface.php
1008 /modules/gmerchantcenterpro/models/Feeds.php
1009 /modules/gremarketing/lib/tags/baseDynTag.php
1010 /modules/gremarketing/lib/tags/dynamicCategoryTag.php
1011 /var/cache/prod/smarty/compile/shopwarehouse/2f/9e/ea/2f9eea5170ce390e3df3ef367d69faf4aa1dac49_2.file.header.tpl.php
1012 /modules/connettore/connettore.php
1013 /modules/connettore/configurazione/configurazione_connettore.php
1014 /modules/connettore/classes/AnubiLogger.php
1015 /modules/connettore/classes/AnubiDbPDO.php
1016 /modules/connettore/classes/DbWrapper.php
1017 /modules/connettore/classes/BaseTask.php
1018 /modules/connettore/classes/DbConnettore.php
1019 /modules/connettore/classes/WebHelper.php
1020 /modules/connettore/classes/Utils.php
1021 /modules/connettore/classes/TestataOrdine.php
1022 /modules/connettore/classes/RigaOrdine.php
1023 /modules/connettore/tasks/TestTask.php
1024 /modules/connettore/tasks/ImportazioneDatiTask.php
1025 /modules/connettore/tasks/ImportazioneNuoveCategorieTask.php
1026 /modules/connettore/tasks/AggiornamentoCategorieTask.php
1027 /modules/connettore/tasks/ImportazioneNuoveFunzioniTask.php
1028 /modules/connettore/tasks/ImportazioneNuoviProdottiTask.php
1029 /modules/connettore/tasks/AggiornamentoProdottiTask.php
1030 /modules/connettore/tasks/ImportazioneImmaginiProdottoTask.php
1031 /modules/connettore/tasks/AttivazioneProdottiTask.php
1032 /modules/connettore/tasks/AggiornamentoDisponibilitaTask.php
1033 /modules/connettore/tasks/ImportazioneNuoviManufacturerTask.php
1034 /modules/connettore/tasks/EliminaProdottiCheNonEsistonoTask.php
1035 /modules/connettore/tasks/ImportazioneCorrelatiTask.php
1036 /modules/connettore/tasks/AggiornamentoTagTask.php
1037 /modules/connettore/tasks/AggiornamentoGiacenzeTask.php
1038 /modules/connettore/tasks/IndicizzazioneProdottiTask.php
1039 /modules/connettore/translations/it.php
1040 /modules/feedaty/feedaty.php
1041 /modules/feedaty/translations/it.php
1042 /modules/feedaty/it.php
1043 /modules/feedaty/lib/FeedatyClasses.php
1044 /modules/feedaty/lib/FeedatyWebservice.php
1045 /modules/feedaty/lib/FeedatyPositions.php
1046 /modules/feedaty/lib/FeedatyProtocols.php
1047 /modules/feedaty/lib/FeedatyGenerateElements.php
1048 /modules/feedaty/lib/FeedatyCsvController.php
1049 /modules/tec_dataminimizer/tec_dataminimizer.php
1050 /modules/ec_minorder/ec_minorder.php
1051 /modules/ec_minorder/translations/it.php
1052 /modules/multipleprices/multipleprices.php
1053 /modules/multipleprices/classes/MultiplepricesConfiguration.php
1054 /modules/multipleprices/translations/it.php
1055 /var/cache/prod/smarty/compile/shopwarehouse/1e/5b/1e/1e5b1ed75e7d2edf5948921999bdb0cfc282f073_2.file.styles.tpl.php
1056 /modules/payplug/payplug.php
1057 /modules/payplug/translations/it.php
1058 /modules/payplug/classes/PayPlugDependencies.php
1059 /modules/payplug/classes/DependenciesClass.php
1060 /modules/payplug/src/utilities/validators/accountValidator.php
1061 /modules/payplug/src/utilities/validators/browserValidator.php
1062 /modules/payplug/src/utilities/validators/cardValidator.php
1063 /modules/payplug/src/utilities/validators/lockValidator.php
1064 /modules/payplug/src/utilities/validators/loggerValidator.php
1065 /modules/payplug/src/utilities/validators/moduleValidator.php
1066 /modules/payplug/src/utilities/validators/orderValidator.php
1067 /modules/payplug/src/utilities/validators/paymentValidator.php
1068 /modules/payplug/src/utilities/helpers/AmountHelper.php
1069 /modules/payplug/src/utilities/helpers/ConfigurationHelper.php
1070 /modules/payplug/src/utilities/helpers/CookiesHelper.php
1071 /modules/payplug/src/utilities/helpers/FilesHelper.php
1072 /modules/payplug/src/utilities/helpers/PhoneHelper.php
1073 /modules/payplug/src/utilities/helpers/UserHelper.php
1074 /modules/payplug/src/application/dependencies/PluginInit.php
1075 /modules/payplug/src/application/dependencies/BaseClass.php
1076 /modules/payplug/src/actions/CardAction.php
1077 /modules/payplug/src/actions/CartAction.php
1078 /modules/payplug/src/actions/ConfigurationAction.php
1079 /modules/payplug/src/actions/MerchantTelemetryAction.php
1080 /modules/payplug/src/actions/OnboardingAction.php
1081 /modules/payplug/src/actions/OneyAction.php
1082 /modules/payplug/src/actions/OrderAction.php
1083 /modules/payplug/src/actions/RefundAction.php
1084 /modules/payplug/src/actions/OrderStateAction.php
1085 /modules/payplug/src/actions/PaymentAction.php
1086 /modules/payplug/src/models/entities/CacheEntity.php
1087 /modules/payplug/src/models/entities/OneyEntity.php
1088 /modules/payplug/src/models/entities/PluginEntity.php
1089 /modules/payplug/src/models/entities/OrderStateEntity.php
1090 /modules/payplug/src/application/adapter/AddressAdapter.php
1091 /modules/payplug/src/interfaces/AddressInterface.php
1092 /modules/payplug/src/application/adapter/AssignAdapter.php
1093 /modules/payplug/src/interfaces/AssignInterface.php
1094 /modules/payplug/src/application/adapter/CarrierAdapter.php
1095 /modules/payplug/src/interfaces/CarrierInterface.php
1096 /classes/Carrier.php
1097 /modules/payplug/src/application/adapter/CartAdapter.php
1098 /modules/payplug/src/interfaces/CartInterface.php
1099 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
1100 /modules/payplug/src/interfaces/ConfigurationInterface.php
1101 /modules/payplug/src/application/adapter/ConstantAdapter.php
1102 /modules/payplug/src/interfaces/ConstantInterface.php
1103 /modules/payplug/src/application/adapter/ContextAdapter.php
1104 /modules/payplug/src/interfaces/ContextInterface.php
1105 /modules/payplug/src/application/adapter/CountryAdapter.php
1106 /modules/payplug/src/interfaces/CountryInterface.php
1107 /modules/payplug/src/application/adapter/CurrencyAdapter.php
1108 /modules/payplug/src/interfaces/CurrencyInterface.php
1109 /modules/payplug/src/application/adapter/CustomerAdapter.php
1110 /modules/payplug/src/interfaces/CustomerInterface.php
1111 /modules/payplug/src/application/adapter/DispatcherAdapter.php
1112 /modules/payplug/src/interfaces/DispatcherInterface.php
1113 /modules/payplug/src/application/adapter/LanguageAdapter.php
1114 /modules/payplug/src/interfaces/LanguageInterface.php
1115 /modules/payplug/src/application/adapter/MediaAdapter.php
1116 /modules/payplug/src/interfaces/MediaInterface.php
1117 /modules/payplug/src/application/adapter/MessageAdapter.php
1118 /modules/payplug/src/interfaces/MessageInterface.php
1119 /modules/payplug/src/application/adapter/ModuleAdapter.php
1120 /modules/payplug/src/interfaces/ModuleInterface.php
1121 /modules/payplug/src/application/adapter/OrderAdapter.php
1122 /modules/payplug/src/interfaces/OrderInterface.php
1123 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
1124 /modules/payplug/src/interfaces/OrderHistoryInterface.php
1125 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
1126 /modules/payplug/src/interfaces/OrderSlipInterface.php
1127 /modules/payplug/src/application/adapter/OrderStateAdapter.php
1128 /modules/payplug/src/interfaces/OrderStateInterface.php
1129 /classes/order/OrderState.php
1130 /modules/payplug/src/application/adapter/ProductAdapter.php
1131 /modules/payplug/src/interfaces/ProductInterface.php
1132 /modules/payplug/src/application/adapter/QueryAdapter.php
1133 /modules/payplug/src/interfaces/QueryInterface.php
1134 /modules/payplug/src/application/adapter/ShopAdapter.php
1135 /modules/payplug/src/interfaces/ShopInterface.php
1136 /modules/payplug/src/application/adapter/TabAdapter.php
1137 /modules/payplug/src/interfaces/TabInterface.php
1138 /modules/payplug/src/application/adapter/ToolsAdapter.php
1139 /modules/payplug/src/interfaces/ToolsInterface.php
1140 /modules/payplug/src/application/adapter/TranslationAdapter.php
1141 /modules/payplug/src/interfaces/TranslationInterface.php
1142 /modules/payplug/src/application/adapter/ValidateAdapter.php
1143 /modules/payplug/src/interfaces/ValidateInterface.php
1144 /modules/payplug/src/models/classes/Address.php
1145 /modules/payplug/src/models/classes/ApiRest.php
1146 /modules/payplug/src/models/classes/Configuration.php
1147 /modules/payplug/src/models/classes/Country.php
1148 /modules/payplug/src/models/classes/Order.php
1149 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
1150 /modules/payplug/src/models/classes/Translation.php
1151 /modules/payplug/src/models/repositories/CardRepository.php
1152 /modules/payplug/src/models/repositories/QueryRepository.php
1153 /modules/payplug/src/models/repositories/CacheRepository.php
1154 /modules/payplug/src/models/repositories/CountryRepository.php
1155 /modules/payplug/src/models/repositories/LockRepository.php
1156 /modules/payplug/src/models/repositories/LoggerRepository.php
1157 /modules/payplug/src/models/repositories/ModuleRepository.php
1158 /modules/payplug/src/models/repositories/OrderRepository.php
1159 /modules/payplug/src/models/repositories/OrderStateRepository.php
1160 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
1161 /modules/payplug/src/models/repositories/PaymentRepository.php
1162 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
1163 /modules/payplug/src/models/repositories/ShopRepository.php
1164 /modules/payplug/classes/MyLogPHP.php
1165 /modules/payplug/src/repositories/LoggerRepository.php
1166 /modules/payplug/src/models/entities/LoggerEntity.php
1167 /modules/payplug/src/repositories/TranslationsRepository.php
1168 /modules/payplug/src/repositories/SQLtableRepository.php
1169 /modules/payplug/src/repositories/CacheRepository.php
1170 /modules/payplug/src/repositories/OrderStateRepository.php
1171 /modules/payplug/src/repositories/InstallRepository.php
1172 /modules/payplug/src/utilities/services/API.php
1173 /modules/payplug/src/utilities/services/Browser.php
1174 /modules/payplug/src/utilities/services/Routes.php
1175 /modules/payplug/src/utilities/services/MerchantTelemetry.php
1176 /modules/payplug/classes/ApiClass.php
1177 /modules/payplug/classes/ApplePayClass.php
1178 /modules/payplug/classes/AmountCurrencyClass.php
1179 /modules/payplug/classes/AdminClass.php
1180 /modules/payplug/classes/PayplugLock.php
1181 /modules/payplug/classes/CartClass.php
1182 /modules/payplug/classes/ConfigClass.php
1183 /modules/payplug/classes/InstallmentClass.php
1184 /modules/payplug/classes/HookClass.php
1185 /modules/payplug/classes/MediaClass.php
1186 /modules/payplug/classes/OrderClass.php
1187 /modules/payplug/classes/PaymentClass.php
1188 /modules/payplug/classes/RefundClass.php
1189 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1190 /modules/sendinblue/sendinblue.php
1191 /modules/sendinblue/translations/it.php
1192 /modules/sendinblue/services/ConfigService.php
1193 /modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php
1194 /modules/absfrequentlyboughttogether/class/AbsBuyItWith.php
1195 /modules/absfrequentlyboughttogether/class/AbsPromoFqb.php
1196 /modules/absfrequentlyboughttogether/translations/it.php
1197 /modules/trustedprogramintegration/trustedprogramintegration.php
1198 /modules/trustedprogramintegration/translations/it.php
1199 /src/Core/Product/Search/ProductSearchContext.php
1200 /src/Core/Product/Search/ProductSearchQuery.php
1201 /src/Core/Product/Search/SortOrder.php
1202 /modules/ps_facetedsearch/ps_facetedsearch.php
1203 /modules/ps_facetedsearch/src/HookDispatcher.php
1204 /modules/ps_facetedsearch/src/Hook/Attribute.php
1205 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1206 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1207 /modules/ps_facetedsearch/src/Hook/Category.php
1208 /modules/ps_facetedsearch/src/Hook/Configuration.php
1209 /modules/ps_facetedsearch/src/Hook/Design.php
1210 /modules/ps_facetedsearch/src/Hook/Feature.php
1211 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1212 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1213 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1214 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1215 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1216 /modules/ps_facetedsearch/src/Hook/Product.php
1217 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1218 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1219 /modules/ps_facetedsearch/src/Filters/Provider.php
1220 /modules/ps_facetedsearch/src/URLSerializer.php
1221 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1222 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1223 /src/Core/Product/Search/FacetsRendererInterface.php
1224 /src/Core/Product/Search/ProductSearchProviderInterface.php
1225 /modules/ps_facetedsearch/src/Filters/Converter.php
1226 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1227 /src/Core/Product/Search/ProductSearchResult.php
1228 /modules/ps_facetedsearch/src/Product/Search.php
1229 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1230 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1231 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1232 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1233 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1234 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1235 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1236 /modules/ps_facetedsearch/src/Filters/Products.php
1237 /modules/ps_facetedsearch/src/Filters/Block.php
1238 /modules/ps_facetedsearch/src/Definition/Availability.php
1239 /src/Core/Util/String/StringModifier.php
1240 /src/Core/Util/String/StringModifierInterface.php
1241 /src/Core/Product/Search/Facet.php
1242 /src/Core/Product/Search/Filter.php
1243 /src/Core/Product/Search/FacetCollection.php
1244 /classes/ProductAssembler.php
1245 /classes/ProductPresenterFactory.php
1246 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1247 /src/Adapter/Presenter/Product/ProductPresenter.php
1248 /src/Adapter/Product/ProductColorsRetriever.php
1249 /src/Core/Product/ProductPresentationSettings.php
1250 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1251 /src/Adapter/Presenter/Product/ProductLazyArray.php
1252 /src/Adapter/Presenter/AbstractLazyArray.php
1253 /classes/Image.php
1254 /src/Core/Image/ImageFormatConfiguration.php
1255 /src/Core/Image/ImageFormatConfigurationInterface.php
1256 /classes/FeatureFlag.php
1257 /src/Core/FeatureFlag/FeatureFlagSettings.php
1258 /src/Core/Util/Inflector.php
1259 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1260 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1261 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1262 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1263 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1264 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1265 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1266 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1267 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1268 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1269 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1270 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1271 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1272 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1273 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1274 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1275 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1276 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1277 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1278 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1279 /var/cache/prod/smarty/compile/shopwarehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1280 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1281 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1282 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1283 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1284 /var/cache/prod/smarty/compile/shopwarehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1285 /src/Core/Product/Search/Pagination.php
1286 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f8/11/cb/f811cb95a71b2aadd97e674a0f709876f06d4c42_2.file.category.tpl.php
1287 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1288 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/b2/a5/fe/b2a5fee663562893eda7670099e89eec5d81a1fb_2.file.product-list.tpl.php
1289 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/dd/fe/b9/ddfeb954e222c722253739f7845703c29eaea402_2.file.layout-left-column.tpl.php
1290 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5a/ce/e5/5acee588265771a51ffc84701e00bdd02c9abdf2_2.file.layout-both-columns.tpl.php
1291 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c5/08/43/c508439c1a96a30f9de64446737e6ee1927dfb3b_2.file.helpers.tpl.php
1292 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1293 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/6f/91/236f91d2776e44271e012c43db1c691696c15040_2.file.head.tpl.php
1294 /vendor/smarty/smarty/libs/sysplugins/smarty_undefined_variable.php
1295 /var/cache/prod/smarty/compile/shopwarehouse/27/e9/b0/27e9b031b55351a9f084c5addac17fcde073133e_2.file.gtm_tag.tpl.php
1296 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/fb/db/48/fbdb48daf1e14bbe07fd3699d645f11debb2eb1a_2.file.head-jsonld.tpl.php
1297 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/16/ce/59/16ce59339f787d6cb8ac4f7c0a7f20e99de1b839_2.file.product-list-jsonld.tpl.php
1298 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/0a/0b/4c/0a0b4c89241f913d59419ea9a3612aa6515190d1_2.file.pagination-seo.tpl.php
1299 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1300 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/b9/7c/beb97cb450a9f69fd43c061d99fbdfad7181c6f6_2.file.stylesheets.tpl.php
1301 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ae/4d/30/ae4d30f43146c6e1ffaee0607d30f548b596517f_2.file.javascript.tpl.php
1302 /var/cache/prod/smarty/compile/shopwarehouse/46/35/48/463548647f97f9e2cce954b7188c1f350dab323f_2.file.google_tag_body.tpl.php
1303 /var/cache/prod/smarty/compile/shopwarehouse/5d/db/c8/5ddbc86a06a0a0d6e76e4f9fba4952f2f24c5192_2.file.gtm_tag_noscript.tpl.php
1304 /var/cache/prod/smarty/compile/27/a8/a7/27a8a764939f2f3d8f7490893049eba541e593c2_2.file.view_after_body_opening_tag_header.tpl.php
1305 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/98/20/ef/9820ef0925d3fee40988d8cee22dbe868c6cb068_2.file.product-activation.tpl.php
1306 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/8c/bc/41/8cbc41da8acb85d754b2c50cfefb91ed607a9edf_2.file.header.tpl.php
1307 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e9/b9/d5/e9b9d508f2dd480341846be452ac6f6672284f34_2.file.social-links.tpl.php
1308 /modules/iqitlinksmanager/iqitlinksmanager.php
1309 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1310 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1311 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1312 /modules/iqitlinksmanager/translations/it.php
1313 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1314 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1315 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1316 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayNav1/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1317 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1318 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1319 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1320 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1321 /modules/iqithtmlandbanners/translations/it.php
1322 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayNavCenter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1323 /modules/ps_languageselector/ps_languageselector.php
1324 /modules/ps_currencyselector/ps_currencyselector.php
1325 /var/cache/prod/smarty/compile/shopwarehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1326 /var/cache/prod/smarty/compile/shopwarehouse/a7/b4/2a/a7b42a5e4e0a5166bfca3e9be0e40e49bcdd454f_2.module.iqitcompareviewstemplateshookdisplaynav.tpl.php
1327 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/9a/e8/a0/9ae8a0bf6f8a38863b91cfc212bb6ceb2292b8a7_2.file.header-1.tpl.php
1328 /modules/iqitsearch/iqitsearch.php
1329 /modules/iqitsearch/translations/it.php
1330 /var/cache/prod/smarty/compile/shopwarehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1331 /var/cache/prod/smarty/compile/shopwarehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1332 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/5e/3f/235e3f5ee59d64225af247fb2228e65cd3fe7fb0_2.module.ps_shoppingcartps_shoppingcartdefault.tpl.php
1333 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1334 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1335 /modules/ps_customersignin/ps_customersignin.php
1336 /var/cache/prod/smarty/compile/shopwarehouse/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1337 /modules/pagesnotfound/pagesnotfound.php
1338 /var/cache/prod/smarty/compile/shopwarehouse/63/ba/59/63ba5972c9730522e9fb200398edbc11f4f58089_2.file.feedaty-widget-store.tpl.php
1339 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/10/shopwarehouse/a8/34/6d/a8346d2dc5b79e1534b3385fa0faac4b475b9eb4.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1340 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/1c/e5/92/1ce5928ab8218bc3ddcd60c352dd1d71893f7908_2.file.mobile-header-3.tpl.php
1341 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1342 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1343 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1344 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/62/43/78/624378c7dfeb412830a19d0b0b37a8715548f5cf_2.file.breadcrumb.tpl.php
1345 /modules/iqitproductsnav/iqitproductsnav.php
1346 /modules/iqitproductsnav/translations/it.php
1347 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5e/e2/b8/5ee2b817b44046586c6272340d6af59d1a367ad4_2.file.notifications.tpl.php
1348 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/89/a9/18/89a918329b56f1c800efdd755b39ba9f219ec921_2.file.category-header.tpl.php
1349 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ef/6d/4c/ef6d4c7a880f80029c6b448812468d37383ff042_2.file.category-subcategories.tpl.php
1350 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/26/2c/5e/262c5ee15c17f10153d38421d802f53b3a380c71_2.file.products-top.tpl.php
1351 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1352 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c9/f1/91/c9f191209eb3f477d74071d448cc161f10778b3c_2.file.sort-orders.tpl.php
1353 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c1/47/e9/c147e97b1ab26489e3f10827386d1bcd455d4114_2.file.products.tpl.php
1354 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/b9/de/a6b9dee9c985ceb3eeded4c44440dc98077b6366_2.file.product-list.tpl.php
1355 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/82/b8/3a/82b83aed6eab9dedf4c24a9d0b1f481ebb09cd2c_2.file.product-miniature-thumb.tpl.php
1356 /var/cache/prod/smarty/compile/shopwarehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1357 /vendor/smarty/smarty/libs/plugins/function.math.php
1358 /var/cache/prod/smarty/compile/shopwarehouse/54/50/60/54506057f821234b35c479582bc2dc0b2fc98e35_2.file.artlistproduttori-ps17.tpl.php
1359 /vendor/smarty/smarty/libs/plugins/modifier.date_format.php
1360 /classes/ProductSupplier.php
1361 /vendor/prestashop/decimal/src/Operation/Addition.php
1362 /var/cache/prod/smarty/compile/shopwarehouse/a9/94/a3/a994a3c5a500481515bc7b0596a4818bfcc60e9d_2.file.text.tpl.php
1363 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e5/37/94/e5379437e7cb07eac35c6b76d06b8bbdd09277e9_2.file.product-miniature-btn.tpl.php
1364 /var/cache/prod/smarty/compile/shopwarehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1365 /var/cache/prod/smarty/compile/shopwarehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
1366 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/4d/f5/a64df5b4b109264f55bc8c441b2ddd649e00fe0b_2.file.pagination.tpl.php
1367 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7d/c7/b9/7dc7b920724d67c85c9a1148ffc6e1352c81c741_2.file.products-bottom.tpl.php
1368 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1369 /var/cache/prod/smarty/compile/shopwarehouse/85/b4/27/85b427a04c9571c52bce3e03ca48c19c59f0ab89_2.file.related_posts_category.tpl.cache.php
1370 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1371 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1372 /var/cache/prod/smarty/cache/ybc_blog/7902/1/1/1/10/240508/shopwarehouse/ce/42/62/ce4262669d57a99fd312a58083a030ff04f2f417.related_posts_category.tpl.php
1373 /modules/ps_categorytree/ps_categorytree.php
1374 /var/cache/prod/smarty/compile/shopwarehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1375 /var/cache/prod/smarty/compile/shopwarehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1376 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/31/e3/1e/31e31e2f9e0e15e082e36c94e3ce506f8b52318b_2.file.footer.tpl.php
1377 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/59/d8/c5/59d8c5b4bd8f7dc7e77b4b784cf989309f96e9a6_2.file.footer-2.tpl.php
1378 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayFooter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1379 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayFooter/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1380 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/10/shopwarehouse/31/45/63/3145630ee48f34c64dce20915cd36a7d798fa52b.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1381 /var/cache/prod/smarty/compile/shopwarehouse/59/fa/4a/59fa4a468746e7397894d4d55728b7a0399415fc_2.file.artinvoice_js.tpl.php
1382 /var/cache/prod/smarty/compile/shopwarehouse/c8/59/18/c85918ff6d9da0aabb89af560f45f255349ce95e_2.file.footer.tpl.php
1383 /modules/lgcookieslaw/classes/LGCookiesLawCookie.php
1384 /classes/CMS.php
1385 /var/cache/prod/smarty/compile/b1/74/ee/b174ee22d35566f04bb92c3cdb14885c864f06e9_2.file.view_banner.tpl.php
1386 /var/cache/prod/smarty/compile/shopwarehouse/76/b6/77/76b677d100d34eed3ff7a027ae76cd2d2caafd5f_2.file.shinystat.tpl.php
1387 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f3/e2/01/f3e201110b395deed6ef05594261db3284242b23_2.file.footer-copyrights-1.tpl.php
1388 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d2/ed/33/d2ed337060b8ed3aaacc807eb44ca9f06bc7740c_2.file.password-policy-template.tpl.php
1389 /classes/form/CustomerLoginForm.php
1390 /classes/form/AbstractForm.php
1391 /classes/form/FormInterface.php
1392 /src/Core/Foundation/Templating/RenderableInterface.php
1393 /classes/form/CustomerLoginFormatter.php
1394 /classes/form/FormFormatterInterface.php
1395 /classes/ValidateConstraintTranslator.php
1396 /src/Core/Util/InternationalizedDomainNameConverter.php
1397 /src/Core/Foundation/Templating/RenderableProxy.php
1398 /var/cache/prod/smarty/compile/shopwarehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1399 /classes/form/FormField.php
1400 /var/cache/prod/smarty/compile/shopwarehouse/22/1c/83/221c831891cf43068d82e5d2cedfd7083701554e_2.file.login-form.tpl.php
1401 /var/cache/prod/smarty/compile/shopwarehouse/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1402 /var/cache/prod/smarty/compile/8f/74/7a/8f747aa7caf4a60dae1415d8fc15828b2e6a2977_2.file.form-fields.tpl.php
1403 /var/cache/prod/smarty/compile/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1404 /var/cache/prod/smarty/compile/shopwarehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1405 /modules/statsdata/statsdata.php
1406 /classes/Guest.php
1407 /classes/Connection.php
1408 /classes/Page.php
1409 /classes/ConnectionsSource.php