Warning: Undefined array key "HTTP_ACCEPT_LANGUAGE" in /var/www/vhosts/angoloufficio.it/httpdocs/modules/psrecaptcha/psrecaptcha.php on line 666
timbri
prodotto aggiunto alla lista
Prodotto aggiunto per il confronto.
Load Time 925 ms
Querying Time 663 ms
Queries 941
Memory Peak Usage 23.7 Mb
Included Files 1414 files - 18.11 Mb
PrestaShop Cache - Mb
Global vars 1.39 Mb
PrestaShop Version 8.1.5
PHP Version 8.1.28
MySQL Version 10.1.48-MariaDB-0ubuntu0.18.04.1
Memory Limit 1024M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation never recompile
  Time Cumulated Time Memory Usage Memory Peak Usage
config 19.506 ms 19.506 ms 3.85 Mb 3.9 Mb
__construct 0.059 ms 19.565 ms - Mb 3.9 Mb
init 19.615 ms 39.180 ms 0.75 Mb 4.9 Mb
checkAccess 0.003 ms 39.183 ms - Mb 4.9 Mb
setMedia 7.964 ms 47.147 ms 0.17 Mb 4.9 Mb
postProcess 0.003 ms 47.150 ms - Mb 4.9 Mb
initHeader 0.001 ms 47.151 ms - Mb 4.9 Mb
initContent 764.380 ms 812 ms 11.15 Mb 16.4 Mb
initFooter 0.002 ms 812 ms - Mb 16.4 Mb
display 113.303 ms 925 ms 6.57 Mb 23.7 Mb
Hook Time Memory Usage
DisplayHeader 209.249 ms 7.28 Mb
DisplayProductPriceBlock 15.949 ms 0.80 Mb
DisplayAfterTitleTag 13.979 ms 0.68 Mb
DisplayFooter 9.609 ms 0.40 Mb
DisplayBeforeBodyClosingTag 9.462 ms 0.17 Mb
ActionFrontControllerSetMedia 6.058 ms 0.12 Mb
displayBeforeBodyClosingTag 5.157 ms 0.50 Mb
DisplayFooterCategory 4.616 ms 0.11 Mb
DisplayTop 4.136 ms 0.16 Mb
displayProductListReviews 3.907 ms 0.12 Mb
displayLeftColumn 3.529 ms 0.08 Mb
displayFooter 2.841 ms 0.11 Mb
displayNav2 2.745 ms 0.18 Mb
displayMainMenu 2.253 ms 0.89 Mb
renderWidget 1.990 ms 0.14 Mb
Header 1.967 ms 0.08 Mb
displayNav1 1.568 ms 0.09 Mb
displayCategoryElementor 1.012 ms 0.08 Mb
displayProductListFunctionalButtons 0.972 ms 0.01 Mb
DisplayAfterBodyOpeningTag 0.762 ms 0.04 Mb
displayNavCenter 0.677 ms 0.06 Mb
DisplayProductListReviews 0.612 ms 0.03 Mb
displayAfterBreadcrumb 0.543 ms 0.04 Mb
DisplayFooterAfter 0.517 ms 0.01 Mb
DisplayLeftColumn 0.492 ms 0.10 Mb
IsJustElementor 0.480 ms 0.02 Mb
ActionDispatcherBefore 0.446 ms 0.01 Mb
ProductSearchProvider 0.261 ms 0.01 Mb
ModuleRoutes 0.065 ms 0.03 Mb
OverrideLayoutTemplate 0.057 ms - Mb
ActionDispatcher 0.015 ms - Mb
displayVerticalMenu 0.015 ms - Mb
ActionFrontControllerInitAfter 0.013 ms - Mb
DisplayFooterBefore 0.011 ms - Mb
ActionProductSearchAfter 0.009 ms - Mb
35 hook(s) 305.973 ms 12.35 Mb
Module Time Memory Usage
doofinder 2.601 ms - Mb
ybc_blog 11.819 ms 0.61 Mb
simpleimportproduct 6.438 ms 0.35 Mb
ets_abandonedcart 2.615 ms 0.17 Mb
ps_mbo 3.291 ms 0.11 Mb
iqitthemeeditor 1.454 ms 0.26 Mb
ps_emailsubscription 0.471 ms 0.01 Mb
ps_emailalerts 0.215 ms 0.01 Mb
ps_checkout 5.938 ms - Mb
ps_accounts 0.402 ms - Mb
psrecaptcha 0.680 ms 0.17 Mb
revsliderprestashop 1.656 ms 0.03 Mb
arteinvoice 0.681 ms 0.03 Mb
lgcookieslaw 13.345 ms 0.49 Mb
ps_shoppingcart 0.188 ms 0.01 Mb
productcomments 0.166 ms 0.01 Mb
iqitcompare 2.007 ms 0.04 Mb
iqitcontactpage 2.329 ms 0.07 Mb
iqitcountdown 0.242 ms 0.01 Mb
iqitelementor 1.997 ms 0.11 Mb
iqitfreedeliverycount 0.207 ms 0.01 Mb
iqitmegamenu 2.624 ms 0.90 Mb
iqitreviews 4.077 ms 0.13 Mb
iqitwishlist 6.601 ms 0.55 Mb
iqitextendedproduct 0.265 ms 0.01 Mb
artproduttori 0.860 ms 0.05 Mb
ganalyticspro 185.154 ms 6.25 Mb
shinystat 0.995 ms 0.02 Mb
ets_integrategooglemarketing 0.803 ms 0.04 Mb
cdc_googletagmanager 14.897 ms 0.73 Mb
gremarketing 12.502 ms 0.54 Mb
gmerchantcenterpro 7.440 ms 0.38 Mb
connettore 0.752 ms 0.05 Mb
feedaty 5.299 ms 0.14 Mb
tec_dataminimizer 0.168 ms 0.01 Mb
ec_minorder 0.273 ms 0.01 Mb
multipleprices 14.174 ms 0.74 Mb
payplug 8.509 ms 0.38 Mb
sendinblue 0.471 ms 0.01 Mb
absfrequentlyboughttogether 0.204 ms 0.01 Mb
trustedprogramintegration 0.175 ms 0.01 Mb
ps_facetedsearch 0.927 ms 0.13 Mb
iqitlinksmanager 2.589 ms 0.13 Mb
iqithtmlandbanners 1.588 ms 0.09 Mb
ps_languageselector 0.564 ms 0.05 Mb
ps_currencyselector 0.621 ms 0.05 Mb
iqitsearch 1.367 ms 0.05 Mb
ps_customersignin 1.226 ms 0.09 Mb
pagesnotfound 0.089 ms 0.01 Mb
iqitproductsnav 0.941 ms 0.04 Mb
ps_categorytree 3.738 ms 0.10 Mb
statsdata 9.241 ms 0.17 Mb
52 module(s) 347.874 ms 14.24 Mb

Stopwatch SQL - 941 queries

# Query Time (ms) Rows Filesort Group By Location
807
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=530)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
33.242 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
568
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
19.247 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
652
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=373)) GROUP BY fp.id_feature_value
9.629 ms 12050280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
148
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
6.373 ms 1 /classes/stock/StockAvailable.php:453
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `uag_configuration` c
LEFT JOIN `uag_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
6.228 ms 2111 /classes/Configuration.php:180
834
REPLACE INTO uag_layered_filter_block (hash, data) VALUES ("97344ff6b7a4a9a281e8d661574897f7", "a:1:{s:7:\"filters\";a:7:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:9:\"Categorie\";s:6:\"values\";a:1:{i:8120;a:2:{s:4:\"name\";s:31:\"inchiostro per timbri - tamponi\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilità\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:12:\"In magazzino\";s:3:\"nbr\";i:1;}i:0;a:2:{s:4:\"name\";s:15:\"Non disponibile\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:1:{i:46270;a:2:{s:4:\"name\";s:5:\"Colop\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:3;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Prezzo\";s:3:\"max\";d:5;s:3:\"min\";d:4;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:1;s:5:\"value\";N;}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:280;s:6:\"values\";a:1:{i:26;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:4:\"Nero\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Colore\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:282;s:6:\"values\";a:1:{i:67013;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:7:\"Tamponi\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Tipologia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:6;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:373;s:6:\"values\";a:63:{i:1397;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:3:\"B6K\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:4697;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:24:\"Colop Pocket Stamp PSP20\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5602;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:24:\"Colop Pocket Stamp PSP30\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65424;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:6:\"E/12/2\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1900;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:17:\"E/Pocketstamp R40\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1215;a:4:{s:3:\"nbr\";i:11;s:4:\"name\";s:8:\"In gomma\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65617;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:22:\"In gomma, fotopolimero\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1414;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"In metallo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1381;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:26:\"Printer 10-S120-S160L-S126\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:3026;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"Printer 15\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1366;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:10:\"Printer 20\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1974;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"Printer 25\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1367;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"Printer 30\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1368;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"Printer 40\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2774;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:10:\"Printer 45\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1369;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"Printer 50\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1370;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:10:\"Printer 60\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:4729;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q12\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5746;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q17\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5747;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q20\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5748;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q24\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5744;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q30\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2891;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer Q43\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2288;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R12\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1941;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R17\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1506;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R24\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1375;a:5:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R30\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:2474;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R40\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5228;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R45\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5745;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printer R50\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1903;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:17:\"Printer S260-S220\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65891;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:22:\"Printy 4630, 4630 typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5730;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4638\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:4699;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4642\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65892;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:24:\"Printy 4750, 4750L, 4755\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1602;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:23:\"Printy 4910, 4810, 4836\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1603;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:11:\"Printy 4911\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6278;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:46:\"Printy 4911, 4800, 4820, 4822, 4846, 4911 typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1604;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4912\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6280;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:23:\"Printy 4912, 4912  typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6285;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:22:\"Printy 4912, 4912 typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1605;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:22:\"Printy 4913, 4913 Typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5731;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4914\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1606;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:11:\"Printy 4915\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6284;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:35:\"Printy 4917 4813, 4816, 4817, 48313\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6287;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:28:\"Printy 4926, 4726, 4926 typo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1031;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4927\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5732;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4929\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:9892;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 4931\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6279;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:31:\"Printy 4941 (4760), 4750, 4750L\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1601;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 5206\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:3314;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 9413\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2462;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 9430\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5733;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 9440\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:7665;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 9511\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:7666;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:11:\"Printy 9512\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:3305;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:12:\"Printy 46140\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6282;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:37:\"Professional 5203, 5440, 54440L, 5253\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:6331;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:17:\"Professional 5274\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:65896;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:30:\"Professional 5460, 5460L, 5465\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1925;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:17:\"Professional 5470\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1395;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:45:\"Timbro Classic Line datario 2360, Office S360\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1396;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:32:\"Timbro Classic Line datario 2660\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:10:\"Per timbri\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}}}")
5.684 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
565
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 280 ORDER BY vl.`value` ASC
5.343 ms 507 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
561
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `uag_manufacturer` m INNER JOIN uag_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `uag_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
5.249 ms 738 Yes /classes/Manufacturer.php:211
695
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=417)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
4.745 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
670
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=391)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
4.656 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
556
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
4.563 ms 718 Yes /classes/Category.php:724
26
SELECT SQL_NO_CACHE * FROM `uag_hook_module_exceptions`
WHERE `id_shop` IN (1)
4.150 ms 1 /classes/module/Module.php:2018
549
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `uag_feature` f  INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `uag_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
3.978 ms 280 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
858
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 65907) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
3.956 ms 1 /classes/Product.php:7720
940
INSERT INTO `uag_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('490', '', 'www.angoloufficio.it/7892-timbri?q=Per+timbri-Printer+R30&resultsPerPage=36', '', '2024-05-08 14:19:17')
3.811 ms 1 /classes/ObjectModel.php:622
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `uag_module` m
INNER JOIN uag_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `uag_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `uag_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `uag_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.568 ms 202 Yes Yes /classes/Hook.php:1233
75
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7892 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
3.522 ms 263 /classes/Category.php:1062
83
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `uag_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `uag_hook_alias` ha
INNER JOIN `uag_hook` h ON ha.name = h.name
3.210 ms 0 /classes/Hook.php:1292
830
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=554)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
3.015 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
84
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `uag_hook_module` hm
STRAIGHT_JOIN `uag_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `uag_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.962 ms 666 /classes/Hook.php:456
928
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
2.953 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
710
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=432)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.800 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
694
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=416)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.712 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
23
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*
FROM `uag_feature` f
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1)
ORDER BY f.`position` ASC
2.696 ms 280 Yes /classes/Feature.php:92
698
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=420)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.642 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
901
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitreviews" LIMIT 1
2.597 ms 1 /classes/module/Module.php:2636
812
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=536)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.499 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
689
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=411)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.396 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
667
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=388)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.235 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
726
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=449)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.086 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
699
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=421)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.084 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
691
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=413)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.066 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
806
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=529)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.051 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
800
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=523)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
2.030 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
801
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=524)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.999 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
543
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7892 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
1.992 ms 263 /classes/Category.php:1062
796
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=519)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.958 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
557
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND cg.id_group='1' AND c.level_depth<=5 AND c.nleft>227 AND c.nright<242 GROUP BY cp.id_category
1.945 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
810
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=534)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.945 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
562
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) GROUP BY p.id_manufacturer
1.892 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
687
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=409)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.856 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
690
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=412)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.833 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
558
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value=1375))
1.772 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
566
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=281)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.754 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
654
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=374)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.747 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
795
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=518)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.746 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
122
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24127
ORDER BY f.position ASC
1.731 ms 4 Yes /classes/Product.php:6015
666
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=387)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.677 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
553
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC LIMIT 0, 36
1.670 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
560
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value=1375))
1.654 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
711
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=433)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.653 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
678
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=399)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.640 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
393
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.607 ms 1 /classes/stock/StockAvailable.php:806
65
SELECT SQL_NO_CACHE format
FROM `uag_address_format`
WHERE `id_country` = 10 LIMIT 1
1.593 ms 1 /classes/AddressFormat.php:656
693
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=415)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.587 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
814
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=538)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.586 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
572
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=288)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.554 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
769
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=492)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.549 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
773
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=496)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.545 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
925
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `uag_category` c
INNER JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `uag_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 8
AND nleft >= 227 AND nright <= 242
AND c.id_category IN (
SELECT id_category
FROM `uag_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cl.`name` ASC
1.542 ms 120 Yes /modules/ps_categorytree/ps_categorytree.php:166
922
SELECT SQL_NO_CACHE p.*,pc.id_category, pl.image,pl.thumb, pl.title, pl.description, pl.short_description, pl.meta_keywords, pl.meta_description,pl.url_alias,e.firstname, e.lastname,pc.position,count(pcm.id_comment) as total_comment,IFNULL(ybe.status,1) as status
FROM `uag_ybc_blog_post` p
INNER JOIN `uag_ybc_blog_post_shop` ps ON (p.id_post=ps.id_post AND ps.id_shop='1')
LEFT JOIN `uag_ybc_blog_post_lang` pl ON p.id_post = pl.id_post AND pl.id_lang = 1
LEFT JOIN `uag_ybc_blog_post_category` pc ON (p.id_post = pc.id_post ) 
LEFT JOIN `uag_ybc_blog_post_related_categories` rpc ON (p.id_post = rpc.id_post)
LEFT JOIN `uag_customer` c ON (c.id_customer=p.added_by AND p.is_customer=1)
LEFT JOIN `uag_employee` e ON (e.id_employee=p.added_by AND p.is_customer=0)
LEFT JOIN `uag_ybc_blog_employee` ybe ON ((ybe.id_employee=c.id_customer AND ybe.is_customer=1) OR (ybe.id_employee=e.id_employee AND ybe.is_customer=0))
LEFT JOIN `uag_ybc_blog_comment` pcm on (pcm.id_post=p.id_post)
WHERE 1  AND p.enabled=1 AND rpc.id_category=7892  
GROUP BY p.id_post
ORDER BY p.datetime_added DESC,  p.id_post DESC  LIMIT 0, 6
1.540 ms 1 Yes /modules/ybc_blog/classes/ybc_blog_post_class.php:262
673
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=394)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.534 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
74
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
1.528 ms 0 /classes/module/Module.php:2636
705
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=427)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.499 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
697
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=419)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.494 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
658
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=378)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.478 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
665
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=386)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.467 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
688
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=410)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.454 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
559
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value=1375))
1.439 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
935
INSERT INTO `uag_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
1.438 ms 1 /classes/ObjectModel.php:622
831
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=555)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.426 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
569
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=283)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.419 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
727
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=450)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.416 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
792
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=515)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.401 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
554
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375))
1.393 ms 2 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
567
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=282)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.390 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
866
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 3 AND `id_shop` = 1
1.388 ms 1 /src/Adapter/EntityMapper.php:79
817
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=541)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.375 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
674
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=395)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.371 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
152
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
1.370 ms 1 /classes/Product.php:5655
756
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=479)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.360 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
802
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=525)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.360 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
661
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=382)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.355 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
564
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=280)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.354 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
660
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=380)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.353 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
663
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=384)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.344 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
798
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=521)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.343 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
738
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=461)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.334 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
728
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=451)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.331 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
659
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=379)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.322 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
797
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=520)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.321 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
662
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=383)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.319 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
803
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=526)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.313 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
590
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=306)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.308 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
767
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=490)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.303 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
808
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=532)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.303 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
551
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7892) LIMIT 1
1.298 ms 1 /src/Adapter/EntityMapper.php:71
462
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24143
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
1.285 ms 0 /classes/Product.php:1732
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `uag_hook` h
WHERE (h.active = 1)
1.283 ms 1128 /classes/Hook.php:1332
668
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=389)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.283 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
686
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=408)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.271 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
719
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=441)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.271 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
939
INSERT INTO `uag_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('681', '546', '59242177', '', '1', '1', '2024-05-08 14:19:17')
1.264 ms 1 /classes/ObjectModel.php:622
591
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=307)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.254 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
169
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24132
ORDER BY f.position ASC
1.251 ms 3 Yes /classes/Product.php:6015
715
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=437)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.251 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
692
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=414)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.246 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
609
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=327)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.245 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
649
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=370)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.234 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
762
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=485)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.233 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
758
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=481)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.233 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
608
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=326)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.225 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
679
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=400)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.223 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
702
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=424)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.223 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
709
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=431)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.223 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
725
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=448)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.220 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
629
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=348)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.219 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
671
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=392)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.218 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
653
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 373 ORDER BY vl.`value` ASC
1.215 ms 65 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
786
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=509)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.215 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
680
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=401)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.211 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
700
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=422)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.208 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
664
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=385)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.205 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
724
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=447)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.205 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
815
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=539)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.187 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
644
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=363)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.186 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
813
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=537)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.180 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
824
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=548)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.180 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
823
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=547)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.177 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
657
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=377)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.177 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
648
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=369)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.173 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
651
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=372)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.172 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
655
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=375)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.172 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
656
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=376)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.165 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
548
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM uag_layered_category
WHERE controller = 'category'
AND id_category = 7892
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
1.162 ms 271 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
708
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=430)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.161 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
631
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=350)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.160 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
601
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=318)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.159 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
816
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=540)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.159 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
785
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=508)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.157 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
793
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=516)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.157 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
799
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=522)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.155 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
712
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=434)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.154 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
589
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=305)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.152 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
741
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=464)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.152 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
603
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=320)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.150 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
550
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 373 ORDER BY vl.`value` ASC
1.141 ms 65 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
580
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=296)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.141 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
595
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=311)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.139 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
718
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=440)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.136 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
683
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=405)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.134 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
619
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=338)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.133 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
761
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=484)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.132 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
771
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=494)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.126 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
62
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
1.124 ms 0 /classes/module/Module.php:2636
835
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-05-08 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM uag_product p
LEFT JOIN uag_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN uag_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN uag_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (65907)
1.121 ms 1 /classes/ProductAssembler.php:95
811
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=535)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.120 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
696
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=418)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.119 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
585
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=301)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.117 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
763
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=486)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.114 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
618
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=337)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.113 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
583
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=299)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.109 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
804
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=527)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.109 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
805
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=528)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.107 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
522
SHOW TABLES LIKE "uag_gmcp_1800"
1.101 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
650
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=371)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.101 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
460
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24143) LIMIT 1
1.100 ms 1 /src/Adapter/EntityMapper.php:71
612
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=330)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.099 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
740
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=463)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.097 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
48
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `uag_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 7892
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
1.095 ms 7 Yes Yes /classes/Category.php:924
826
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=550)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.093 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
571
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=287)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.092 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
627
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=346)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.092 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
586
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=302)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.088 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
610
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=328)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.086 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
809
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=533)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.086 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
604
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=322)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.085 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
770
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=493)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.085 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
573
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=289)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.082 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
620
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=339)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.081 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
790
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=513)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.081 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
645
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=366)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.065 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
643
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=362)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.061 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
647
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=368)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.061 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
791
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=514)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.061 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
587
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=303)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.058 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
613
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=332)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.058 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
669
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=390)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.055 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
716
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=438)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.053 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
621
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=340)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.052 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
570
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=284)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.049 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
588
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=304)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.048 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
630
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=349)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.048 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
783
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=506)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.048 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
768
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=491)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.048 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
594
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=310)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.045 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
794
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=517)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.045 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
677
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=398)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.044 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
742
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=465)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.041 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
584
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=300)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.039 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
596
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=312)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.039 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
614
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=333)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.039 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
622
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=341)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.038 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
760
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=483)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.036 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
737
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=460)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.031 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
713
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=435)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.030 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
672
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=393)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.025 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
607
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=325)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.024 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
833
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=561)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.023 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
729
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=452)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.021 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
615
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=334)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.020 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
675
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=396)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.020 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
514
DESCRIBE uag_ybc_blog_post
1.019 ms 1 /modules/ybc_blog/ybc_blog_defines.php:3141
775
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=498)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.011 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
606
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=324)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.009 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
144
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24130 LIMIT 1
1.008 ms 1 /classes/SpecificPrice.php:435
597
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=314)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.008 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
626
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=345)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.008 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
772
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=495)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.007 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
746
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=469)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.006 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
300
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8150 LIMIT 1
1.006 ms 1 /classes/Category.php:1378
739
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=462)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.006 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
759
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=482)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.003 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
784
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=507)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.003 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
581
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=297)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
1.001 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
743
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=466)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.997 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
637
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=356)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.996 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
623
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=342)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.994 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
825
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=549)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.991 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
632
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=351)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
764
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=487)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
832
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=560)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.987 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
598
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=315)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.985 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
600
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=317)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.984 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
676
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=397)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.983 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
706
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=428)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.982 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
751
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=474)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.981 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
779
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=502)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.980 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
639
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=358)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.979 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
822
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=546)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.979 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
578
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=294)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.978 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
789
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=512)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.976 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
617
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=336)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.975 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
628
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=347)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.974 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
707
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=429)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.973 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
818
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=542)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.972 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
827
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=551)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.971 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM uag_shop_group gs
LEFT JOIN uag_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN uag_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.970 ms 1 Yes /classes/shop/Shop.php:715
765
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=488)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.962 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
25
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `uag_meta` m
LEFT JOIN `uag_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.961 ms 64 Yes /classes/Dispatcher.php:654
150
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24130
ORDER BY f.position ASC
0.960 ms 4 Yes /classes/Product.php:6015
744
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=467)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.960 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
582
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=298)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.954 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
717
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=439)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.954 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
104
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24126
AND image_shop.`cover` = 1 LIMIT 1
0.953 ms 1 /classes/Product.php:3570
776
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=499)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.949 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
616
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=335)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.948 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
602
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=319)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.947 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
49
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8117) AND (b.`id_shop` = 1) LIMIT 1
0.946 ms 1 /src/Adapter/EntityMapper.php:71
636
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=355)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.940 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
730
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=453)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.939 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
714
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=436)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.938 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
646
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=367)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.935 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
593
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=309)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.933 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
701
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=423)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.928 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
684
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=406)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.924 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
720
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=443)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.923 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
777
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=500)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.923 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
164
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24132)
0.913 ms 1 /classes/Product.php:3860
592
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=308)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.911 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
579
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=295)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.909 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
611
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=329)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.905 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
681
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=402)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.905 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
723
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=446)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.904 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
787
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=510)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.903 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
735
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=458)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.902 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
685
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=407)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.901 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
821
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=545)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.900 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
774
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=497)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.897 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
625
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=344)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.893 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
605
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=323)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.888 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
574
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=290)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.887 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
721
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=444)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.881 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
599
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=316)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.880 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
819
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=543)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.878 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
778
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=501)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.877 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
752
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=475)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.873 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
747
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=470)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.872 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
34
SELECT SQL_NO_CACHE * FROM `uag_currency` c ORDER BY `iso_code` ASC
0.869 ms 1 Yes /classes/Currency.php:709
750
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=473)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.867 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
624
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=343)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.864 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
732
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=455)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.864 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
703
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=425)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.862 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
722
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=445)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.861 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
749
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=472)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.861 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
736
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=459)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.859 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
820
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=544)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.857 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
757
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=480)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.852 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
828
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=552)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.848 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
733
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=456)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.846 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
642
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=361)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.843 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
575
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=291)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.842 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
640
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=359)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.842 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
754
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=477)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.840 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
704
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=426)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.838 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
638
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=357)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.838 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
755
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=478)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.834 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
753
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=476)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.833 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
576
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=292)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.831 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
682
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=403)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.831 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
633
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=352)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.829 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
788
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=511)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.829 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
780
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=503)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.823 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
634
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=353)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.820 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
766
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=489)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.820 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
745
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=468)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.817 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
252
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24142
ORDER BY f.position ASC
0.814 ms 4 Yes /classes/Product.php:6015
635
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=354)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.810 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
39
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.807 ms 1 /classes/Language.php:883
577
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=293)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.800 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
149
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24130 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24130 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.792 ms 0 /classes/Cart.php:1423
641
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=360)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.792 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
748
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=471)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.786 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
731
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=454)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.778 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `uag_hook`
0.769 ms 1128 /classes/Hook.php:1292
781
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=504)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.767 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
829
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=553)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.760 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM uag_shop_url su
LEFT JOIN uag_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.angoloufficio.it' OR su.domain_ssl = 'www.angoloufficio.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.759 ms 1 Yes /classes/shop/Shop.php:1364
782
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=505)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.750 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
734
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=457)) AND ((fp_1.id_feature_value=1375)) GROUP BY fp.id_feature_value
0.747 ms 2 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
563
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM uag_product p INNER JOIN uag_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1375)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=227 AND c.nright<=242
0.744 ms 1 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.744 ms 129 /classes/module/Module.php:345
461
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24143 AND `id_shop` = 1
0.742 ms 1 /src/Adapter/EntityMapper.php:79
159
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24131
ORDER BY f.position ASC
0.734 ms 4 Yes /classes/Product.php:6015
454
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24142
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.731 ms 0 /classes/Product.php:1732
85
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.724 ms 2 Yes /classes/tax/TaxRulesTaxManager.php:109
27
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.722 ms 129 /classes/module/Module.php:345
64
SELECT SQL_NO_CACHE * FROM `uag_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.714 ms 8 Yes /classes/ImageType.php:109
114
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24127
AND image_shop.`cover` = 1 LIMIT 1
0.714 ms 1 /classes/Product.php:3570
233
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24140 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24140 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.710 ms 0 /classes/Cart.php:1423
865
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 3) LIMIT 1
0.706 ms 1 /src/Adapter/EntityMapper.php:71
206
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24137 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24137 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.702 ms 0 /classes/Cart.php:1423
95
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24124
AND image_shop.`cover` = 1 LIMIT 1
0.689 ms 1 /classes/Product.php:3570
904
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (65907) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.679 ms 1 Yes Yes /classes/Product.php:4520
532
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.iso_lang="it") AND (ff.id_shop=1)
0.677 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:109
916
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.671 ms 0 /classes/tax/TaxRulesTaxManager.php:109
32
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.646 ms 129 /classes/module/Module.php:345
516
SELECT SQL_NO_CACHE ac.id_ets_abancart_campaign
FROM `uag_ets_abancart_campaign` ac
LEFT JOIN `uag_ets_abancart_campaign_country` `cc` ON cc.id_ets_abancart_campaign = ac.id_ets_abancart_campaign
LEFT JOIN `uag_ets_abancart_campaign_with_lang` `cl` ON cl.id_ets_abancart_campaign = ac.id_ets_abancart_campaign AND cl.id_lang=1
LEFT JOIN `uag_ets_abancart_campaign_group` `acg` ON ac.id_ets_abancart_campaign = acg.id_ets_abancart_campaign
LEFT JOIN `uag_group_shop` `gs` ON gs.id_group = acg.id_group AND gs.id_shop = 1
WHERE (ac.id_shop = 1) AND (ac.enabled = 1 AND ac.deleted = 0) AND (IF(ac.is_all_lang != 1, cl.id_ets_abancart_campaign is NOT NULL AND cl.id_lang=1, 1)) AND (ac.campaign_type != 'email') AND (ac.campaign_type != 'customer') AND (IF(ac.min_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.min_total_cart <= 0, 1) AND IF(ac.max_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.max_total_cart >= 0, 1)) AND (IF(ac.available_from is NOT NULL, ac.available_from <= '2024-05-08', 1) AND IF(ac.available_to is NOT NULL, ac.available_to >= '2024-05-08', 1)) AND (IF(ac.has_applied_voucher = 'both' OR (ac.has_applied_voucher = 'yes' AND 0 > 0) OR (ac.has_applied_voucher = 'no' AND 0 = 0), 1, 0)) AND (IF(ac.has_product_in_cart = 1, 0, 1)) AND (acg.id_group = 1) AND (ac.is_all_country = 1 OR cc.id_country = -1 OR cc.id_country=10)
GROUP BY ac.id_ets_abancart_campaign
0.642 ms 1 Yes /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:407
316
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.636 ms 1 /classes/stock/StockAvailable.php:778
531
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1)
0.634 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:91
20
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.612 ms 1 Yes Yes /classes/Supplier.php:139
57
SELECT SQL_NO_CACHE 1 FROM uag_cart_product cp INNER JOIN uag_product p
ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.591 ms 1 /classes/Cart.php:4210
493
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24147 AND `id_shop` = 1
0.586 ms 1 /src/Adapter/EntityMapper.php:79
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM uag_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.584 ms 1 /classes/shop/ShopUrl.php:182
72
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.577 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
139
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24129 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24129 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.577 ms 0 /classes/Cart.php:1423
130
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24128 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24128 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.574 ms 0 /classes/Cart.php:1423
140
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24129
ORDER BY f.position ASC
0.568 ms 4 Yes /classes/Product.php:6015
307
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24148 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24148 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.567 ms 0 /classes/Cart.php:1423
391
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.553 ms 1 /classes/stock/StockAvailable.php:778
117
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24127)
0.551 ms 1 /classes/Product.php:3860
284
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24146)
0.532 ms 1 /classes/Product.php:3860
851
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.532 ms 1 /classes/Category.php:2242
919
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 65907 LIMIT 1
0.530 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
386
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24133) LIMIT 1
0.529 ms 1 /src/Adapter/EntityMapper.php:71
847
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 65907
ORDER BY `position`
0.520 ms 1 Yes /classes/Product.php:3545
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.519 ms 129 /classes/module/Module.php:345
121
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24127 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24127 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.519 ms 0 /classes/Cart.php:1423
308
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24148
ORDER BY f.position ASC
0.518 ms 5 Yes /classes/Product.php:6015
298
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24147
ORDER BY f.position ASC
0.505 ms 4 Yes /classes/Product.php:6015
112
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24126 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24126 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.501 ms 0 /classes/Cart.php:1423
394
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24134) LIMIT 1
0.499 ms 1 /src/Adapter/EntityMapper.php:71
58
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.498 ms 3 /classes/CartRule.php:357
151
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24131
AND image_shop.`cover` = 1 LIMIT 1
0.497 ms 1 /classes/Product.php:3570
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `uag_lang` l
JOIN uag_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.494 ms 1 /classes/Language.php:1216
22
SELECT SQL_NO_CACHE DISTINCT g.`id_group`, g.`reduction`, g.`price_display_method`, g.`show_prices`, gl.`name`
FROM `uag_group` g
LEFT JOIN `uag_group_lang` AS gl ON (g.`id_group` = gl.`id_group` AND gl.`id_lang` = 1)
ORDER BY g.`id_group` ASC
0.488 ms 6 Yes /classes/Group.php:111
856
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 65907) LIMIT 1
0.483 ms 1 /src/Adapter/EntityMapper.php:71
178
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24133
ORDER BY f.position ASC
0.480 ms 3 Yes /classes/Product.php:6015
870
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 227 AND c.`nright` >= 242 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.474 ms 115 /classes/Category.php:1600
288
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24146 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24146 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.473 ms 0 /classes/Cart.php:1423
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.472 ms 129 /classes/module/Module.php:345
66
SELECT SQL_NO_CACHE `need_identification_number`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.472 ms 1 /classes/Country.php:405
260
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24143 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24143 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.471 ms 0 /classes/Cart.php:1423
844
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 65907 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 65907 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.469 ms 0 /classes/Cart.php:1423
113
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24126
ORDER BY f.position ASC
0.467 ms 4 Yes /classes/Product.php:6015
188
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24134
ORDER BY f.position ASC
0.465 ms 3 Yes /classes/Product.php:6015
158
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24131 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24131 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.460 ms 0 /classes/Cart.php:1423
92
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24123 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24123 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.458 ms 0 /classes/Cart.php:1423
154
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24131)
0.453 ms 1 /classes/Product.php:3860
927
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.452 ms 1 /classes/module/Module.php:2109
168
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24132 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24132 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1423
511
SELECT SQL_NO_CACHE g.id_group as value, gl.name as label FROM `uag_group` g
LEFT JOIN `uag_group_lang` gl ON (g.id_group=gl.id_group AND gl.id_lang="1")
WHERE g.id_group !="1" AND g.id_group !="2"
0.451 ms 6 /modules/ybc_blog/ybc_blog_defines.php:3038
913
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:19:17" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:19:17" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(46270, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.451 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
279
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24145 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24145 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.450 ms 0 /classes/Cart.php:1423
197
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24136 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24136 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.446 ms 0 /classes/Cart.php:1423
242
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24141 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24141 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.446 ms 0 /classes/Cart.php:1423
102
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24124 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24124 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.445 ms 0 /classes/Cart.php:1423
153
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24131 LIMIT 1
0.445 ms 1 /classes/SpecificPrice.php:435
54
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8150) AND (b.`id_shop` = 1) LIMIT 1
0.444 ms 1 /src/Adapter/EntityMapper.php:71
320
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24124) LIMIT 1
0.442 ms 1 /src/Adapter/EntityMapper.php:71
224
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24139 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.440 ms 0 /classes/Cart.php:1423
215
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24138 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24138 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.438 ms 0 /classes/Cart.php:1423
93
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24123
ORDER BY f.position ASC
0.429 ms 3 Yes /classes/Product.php:6015
270
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24144 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24144 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.428 ms 0 /classes/Cart.php:1423
846
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 65907) AND (b.`id_shop` = 1) LIMIT 1
0.428 ms 1 /src/Adapter/EntityMapper.php:71
177
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24133 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24133 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.427 ms 0 /classes/Cart.php:1423
181
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24134) AND (b.`id_shop` = 1) LIMIT 1
0.427 ms 1 /src/Adapter/EntityMapper.php:71
264
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24144) AND (b.`id_shop` = 1) LIMIT 1
0.425 ms 1 /src/Adapter/EntityMapper.php:71
855
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 227 AND c.`nright` >= 242 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.425 ms 115 /classes/Category.php:1600
261
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24143
ORDER BY f.position ASC
0.416 ms 4 Yes /classes/Product.php:6015
929
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 1) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.415 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
452
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24142) LIMIT 1
0.415 ms 1 /src/Adapter/EntityMapper.php:71
923
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.414 ms 1 /classes/module/Module.php:2636
207
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24137
ORDER BY f.position ASC
0.413 ms 3 Yes /classes/Product.php:6015
234
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24140
ORDER BY f.position ASC
0.411 ms 4 Yes /classes/Product.php:6015
926
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.411 ms 1 /classes/module/Module.php:2636
131
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24128
ORDER BY f.position ASC
0.407 ms 4 Yes /classes/Product.php:6015
251
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24142 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24142 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.407 ms 0 /classes/Cart.php:1423
94
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.406 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:109
921
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:19:17" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:19:17" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(46270, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.406 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
76
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24123
AND image_shop.`cover` = 1 LIMIT 1
0.405 ms 1 /classes/Product.php:3570
216
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24138
ORDER BY f.position ASC
0.404 ms 4 Yes /classes/Product.php:6015
909
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 65907
0.398 ms 3 /override/classes/Product.php:24
934
SELECT SQL_NO_CACHE *
FROM `uag_cms` a
LEFT JOIN `uag_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `uag_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) AND (b.`id_shop` = 1) LIMIT 1
0.394 ms 1 /src/Adapter/EntityMapper.php:71
225
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24139
ORDER BY f.position ASC
0.393 ms 4 Yes /classes/Product.php:6015
243
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24141
ORDER BY f.position ASC
0.392 ms 4 Yes /classes/Product.php:6015
533
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'IT' LIMIT 1
0.392 ms 1 /classes/Country.php:194
933
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 5) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.392 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
103
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24124
ORDER BY f.position ASC
0.391 ms 3 Yes /classes/Product.php:6015
907
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:19:17" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:19:17" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(46270, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.390 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
289
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24146
ORDER BY f.position ASC
0.388 ms 4 Yes /classes/Product.php:6015
229
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24140)
0.388 ms 1 /classes/Product.php:3860
303
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24148)
0.386 ms 1 /classes/Product.php:3860
492
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24147) LIMIT 1
0.386 ms 1 /src/Adapter/EntityMapper.php:71
3
SELECT SQL_NO_CACHE *
FROM `uag_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.385 ms 1 /src/Adapter/EntityMapper.php:71
545
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "payplug" LIMIT 1
0.385 ms 1 /classes/module/Module.php:2636
253
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24143
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 1 /classes/Product.php:3570
280
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24145
ORDER BY f.position ASC
0.383 ms 4 Yes /classes/Product.php:6015
353
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24129) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
33
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7892) AND (b.`id_shop` = 1) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
309
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24123) LIMIT 1
0.383 ms 1 /src/Adapter/EntityMapper.php:71
871
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.383 ms 1 /classes/module/Module.php:2636
143
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24130) AND (b.`id_shop` = 1) LIMIT 1
0.381 ms 1 /src/Adapter/EntityMapper.php:71
377
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24132) LIMIT 1
0.380 ms 1 /src/Adapter/EntityMapper.php:71
890
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.380 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
882
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcompare" LIMIT 1
0.378 ms 1 /classes/module/Module.php:2636
56
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_accounts" LIMIT 1
0.376 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
936
SELECT SQL_NO_CACHE `id_guest`
FROM `uag_connections`
WHERE `id_guest` = 681
AND `date_add` > '2024-05-08 13:49:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.375 ms 1 Yes /classes/Connection.php:168
438
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24140
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.374 ms 0 /classes/Product.php:1732
198
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24136
ORDER BY f.position ASC
0.371 ms 3 Yes /classes/Product.php:6015
19
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.370 ms 129 /classes/module/Module.php:345
411
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24137) LIMIT 1
0.370 ms 1 /src/Adapter/EntityMapper.php:71
145
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24130)
0.369 ms 1 /classes/Product.php:3860
468
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24144) LIMIT 1
0.366 ms 1 /src/Adapter/EntityMapper.php:71
850
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c WHERE c.id_category = 7892 LIMIT 1
0.363 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
428
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24139) LIMIT 1
0.363 ms 1 /src/Adapter/EntityMapper.php:71
297
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24147 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24147 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.360 ms 0 /classes/Cart.php:1423
17
SELECT SQL_NO_CACHE name, alias FROM `uag_hook_alias`
0.359 ms 88 /classes/Hook.php:339
845
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 65907
ORDER BY f.position ASC
0.357 ms 3 Yes /classes/Product.php:6015
361
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24130) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
402
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24136) LIMIT 1
0.354 ms 1 /src/Adapter/EntityMapper.php:71
82
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24123 AND id_shop=1 LIMIT 1
0.351 ms 1 /classes/Product.php:6870
328
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24126) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
135
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24129)
0.348 ms 1 /classes/Product.php:3860
911
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 65907 LIMIT 1
0.346 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
71
SELECT SQL_NO_CACHE *
FROM `uag_category` a0
LEFT JOIN `uag_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 227) AND (a0.`nright` > 242) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.343 ms 115 /classes/PrestaShopCollection.php:383
98
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24124)
0.343 ms 1 /classes/Product.php:3860
544
SELECT SQL_NO_CACHE `name`
FROM `uag_hook`
WHERE `id_hook` = 1003 LIMIT 1
0.343 ms 1 /classes/Hook.php:244
453
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24142 AND `id_shop` = 1
0.340 ms 1 /src/Adapter/EntityMapper.php:79
500
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24148) LIMIT 1
0.340 ms 1 /src/Adapter/EntityMapper.php:71
476
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24145) LIMIT 1
0.337 ms 1 /src/Adapter/EntityMapper.php:71
170
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24133
AND image_shop.`cover` = 1 LIMIT 1
0.336 ms 1 /classes/Product.php:3570
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `uag_hook_alias`
0.334 ms 88 /classes/Hook.php:287
419
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24138) LIMIT 1
0.334 ms 1 /src/Adapter/EntityMapper.php:71
187
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 24134 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 24134 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.332 ms 0 /classes/Cart.php:1423
193
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24136)
0.332 ms 1 /classes/Product.php:3860
40
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.331 ms 1 /src/Adapter/EntityMapper.php:71
502
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24148
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.329 ms 0 /classes/Product.php:1732
271
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 24144
ORDER BY f.position ASC
0.328 ms 4 Yes /classes/Product.php:6015
896
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.326 ms 1 /classes/module/Module.php:2636
228
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24140 LIMIT 1
0.326 ms 1 /classes/SpecificPrice.php:435
369
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24131) LIMIT 1
0.324 ms 1 /src/Adapter/EntityMapper.php:71
59
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.322 ms 3 /classes/CartRule.php:423
345
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24128) LIMIT 1
0.322 ms 1 /src/Adapter/EntityMapper.php:71
61
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.317 ms 1 /classes/CartRule.php:423
60
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.316 ms 3 /classes/CartRule.php:357
21
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.315 ms 1 Yes Yes /classes/Supplier.php:139
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM uag_shop s
LEFT JOIN uag_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.315 ms 1 /classes/shop/Shop.php:218
889
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.315 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
892
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.313 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
127
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24128 AND id_shop=1 LIMIT 1
0.312 ms 1 /classes/Product.php:6870
887
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 8 AND `id_shop` = 1 LIMIT 1
0.312 ms 1 /classes/module/Module.php:2109
123
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24128
AND image_shop.`cover` = 1 LIMIT 1
0.311 ms 1 /classes/Product.php:3570
486
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24146
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.310 ms 0 /classes/Product.php:1732
160
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24132
AND image_shop.`cover` = 1 LIMIT 1
0.309 ms 1 /classes/Product.php:3570
173
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24133)
0.308 ms 1 /classes/Product.php:3860
484
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24146) LIMIT 1
0.308 ms 1 /src/Adapter/EntityMapper.php:71
199
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24137
AND image_shop.`cover` = 1 LIMIT 1
0.307 ms 1 /classes/Product.php:3570
432
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24139
0.307 ms 1 /classes/Tag.php:244
429
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24139 AND `id_shop` = 1
0.305 ms 1 /src/Adapter/EntityMapper.php:79
501
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24148 AND `id_shop` = 1
0.305 ms 1 /src/Adapter/EntityMapper.php:79
912
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 65907)
GROUP BY a0.`id_supplier`
0.302 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
836
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 65907
AND image_shop.`cover` = 1 LIMIT 1
0.300 ms 1 /classes/Product.php:3570
842
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 65907 AND `id_group` = 1 LIMIT 1
0.300 ms 0 /classes/GroupReduction.php:156
436
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24140) LIMIT 1
0.298 ms 1 /src/Adapter/EntityMapper.php:71
840
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 65907)
0.298 ms 1 /classes/Product.php:3860
920
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 65907)
GROUP BY a0.`id_supplier`
0.298 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
444
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24141) LIMIT 1
0.297 ms 1 /src/Adapter/EntityMapper.php:71
938
SELECT SQL_NO_CACHE `id_page`
FROM `uag_page`
WHERE `id_page_type` = 7 AND `id_object` = 7892 LIMIT 1
0.296 ms 1 /classes/Page.php:83
275
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24145)
0.295 ms 1 /classes/Product.php:3860
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `uag_lang` l
LEFT JOIN `uag_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.293 ms 1 /classes/Language.php:1080
873
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `uag_currency` c
LEFT JOIN uag_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.293 ms 1 /classes/Currency.php:1136
162
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8120 LIMIT 1
0.291 ms 1 /classes/Product.php:5655
51
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8119) AND (b.`id_shop` = 1) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
52
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8120) AND (b.`id_shop` = 1) LIMIT 1
0.291 ms 1 /src/Adapter/EntityMapper.php:71
235
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24141
AND image_shop.`cover` = 1 LIMIT 1
0.287 ms 1 /classes/Product.php:3570
517
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenterpro" LIMIT 1
0.287 ms 1 /classes/module/Module.php:2636
81
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24123)
0.286 ms 1 /classes/Product.php:3860
129
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24128) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.284 ms 1 /classes/stock/StockAvailable.php:453
108
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24126)
0.283 ms 1 /classes/Product.php:3860
302
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24148 LIMIT 1
0.283 ms 1 /classes/SpecificPrice.php:435
8
SELECT SQL_NO_CACHE *
FROM `uag_lang` a
LEFT JOIN `uag_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.282 ms 1 /src/Adapter/EntityMapper.php:71
463
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24143 LIMIT 1
0.282 ms 1 /classes/Product.php:1106
293
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24147)
0.281 ms 1 /classes/Product.php:3860
256
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24143)
0.280 ms 1 /classes/Product.php:3860
430
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24139
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.280 ms 0 /classes/Product.php:1732
857
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 65907 AND `id_shop` = 1
0.280 ms 1 /src/Adapter/EntityMapper.php:79
914
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration` a
WHERE (a.`id_multipleprices_configuration` = 1) LIMIT 1
0.280 ms 1 /src/Adapter/EntityMapper.php:71
126
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24128)
0.279 ms 1 /classes/Product.php:3860
226
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24140
AND image_shop.`cover` = 1 LIMIT 1
0.279 ms 1 /classes/Product.php:3570
161
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8120 LIMIT 1
0.278 ms 1 /classes/Category.php:1378
220
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24139)
0.278 ms 1 /classes/Product.php:3860
262
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24144
AND image_shop.`cover` = 1 LIMIT 1
0.278 ms 1 /classes/Product.php:3570
859
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8120) LIMIT 1
0.278 ms 1 /src/Adapter/EntityMapper.php:71
898
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitelementor" LIMIT 1
0.276 ms 1 /classes/module/Module.php:2636
50
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8118) AND (b.`id_shop` = 1) LIMIT 1
0.275 ms 1 /src/Adapter/EntityMapper.php:71
6
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.275 ms 1 /src/Adapter/EntityMapper.php:71
299
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24148
AND image_shop.`cover` = 1 LIMIT 1
0.274 ms 1 /classes/Product.php:3570
515
UPDATE `uag_ybc_blog_post` SET enabled=1,datetime_added="2024-05-08 14:19:16",datetime_modified="2024-05-08 14:19:16" WHERE datetime_active!="0000-00-00" AND datetime_active is not NULL AND enabled=2 AND datetime_active<=NOW()
0.273 ms 1 /modules/ybc_blog/classes/ybc_blog_post_class.php:622
313
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24123
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.270 ms 0 /classes/Product.php:1732
456
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24142
0.270 ms 1 /classes/Tag.php:244
43
SELECT SQL_NO_CACHE *
FROM `uag_group` a
LEFT JOIN `uag_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.269 ms 1 /src/Adapter/EntityMapper.php:71
237
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24141 LIMIT 1
0.265 ms 1 /classes/SpecificPrice.php:435
247
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24142)
0.262 ms 1 /classes/Product.php:3860
141
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24130
AND image_shop.`cover` = 1 LIMIT 1
0.261 ms 1 /classes/Product.php:3570
494
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24147
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.261 ms 0 /classes/Product.php:1732
73
SELECT SQL_NO_CACHE * FROM uag_revslider_sliders
0.260 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
325
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.260 ms 1 /classes/stock/StockAvailable.php:778
378
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24132 AND `id_shop` = 1
0.260 ms 1 /src/Adapter/EntityMapper.php:79
202
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24137)
0.259 ms 1 /classes/Product.php:3860
217
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24139
AND image_shop.`cover` = 1 LIMIT 1
0.258 ms 1 /classes/Product.php:3570
383
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:753
552
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7892 AND `id_shop` = 1
0.257 ms 1 /src/Adapter/EntityMapper.php:79
888
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715170757
0.257 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
179
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24134
AND image_shop.`cover` = 1 LIMIT 1
0.256 ms 1 /classes/Product.php:3570
337
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 24127) LIMIT 1
0.256 ms 1 /src/Adapter/EntityMapper.php:71
281
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24146
AND image_shop.`cover` = 1 LIMIT 1
0.255 ms 1 /classes/Product.php:3570
354
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24129 AND `id_shop` = 1
0.254 ms 1 /src/Adapter/EntityMapper.php:79
266
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24144)
0.253 ms 1 /classes/Product.php:3860
322
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24124
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.253 ms 0 /classes/Product.php:1732
884
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitsearch" LIMIT 1
0.253 ms 1 /classes/module/Module.php:2636
886
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.253 ms 1 /classes/module/Module.php:2636
41
SELECT SQL_NO_CACHE *
FROM `uag_currency_lang`
WHERE `id_currency` = 1
0.252 ms 1 /src/Adapter/EntityMapper.php:79
46
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7892
AND `id_shop` = 1 LIMIT 1
0.252 ms 1 /classes/Category.php:2450
455
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24142 LIMIT 1
0.251 ms 1 /classes/Product.php:1106
915
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration_lang`
WHERE `id_multipleprices_configuration` = 1
0.251 ms 1 /src/Adapter/EntityMapper.php:79
314
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24123 LIMIT 1
0.250 ms 1 /classes/Product.php:1106
503
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24148 LIMIT 1
0.250 ms 1 /classes/Product.php:1106
363
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24130
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.249 ms 0 /classes/Product.php:1732
555
SELECT SQL_NO_CACHE data FROM uag_layered_filter_block WHERE hash="97344ff6b7a4a9a281e8d661574897f7" LIMIT 1
0.249 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
413
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24137
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.248 ms 0 /classes/Product.php:1732
852
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.248 ms 1 /src/Adapter/EntityMapper.php:71
930
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 2) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.248 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
38
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.247 ms 1 /src/Adapter/EntityMapper.php:71
211
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24138)
0.246 ms 1 /classes/Product.php:3860
238
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24141)
0.246 ms 1 /classes/Product.php:3860
395
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24134 AND `id_shop` = 1
0.246 ms 1 /src/Adapter/EntityMapper.php:79
380
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24132 LIMIT 1
0.245 ms 1 /classes/Product.php:1106
480
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24145
0.244 ms 1 /classes/Tag.php:244
183
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 24134)
0.242 ms 1 /classes/Product.php:3860
357
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24129
0.242 ms 1 /classes/Tag.php:244
55
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8181) AND (b.`id_shop` = 1) LIMIT 1
0.241 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24140 AND `id_group` = 1 LIMIT 1
0.241 ms 0 /classes/GroupReduction.php:156
365
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24130
0.240 ms 1 /classes/Tag.php:244
448
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24141
0.240 ms 1 /classes/Tag.php:244
538
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.240 ms 1 /src/Adapter/EntityMapper.php:71
315
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24123
0.240 ms 1 /classes/Tag.php:244
387
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24133 AND `id_shop` = 1
0.239 ms 1 /src/Adapter/EntityMapper.php:79
405
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24136 LIMIT 1
0.239 ms 1 /classes/Product.php:1106
290
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24147
AND image_shop.`cover` = 1 LIMIT 1
0.238 ms 1 /classes/Product.php:3570
321
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24124 AND `id_shop` = 1
0.237 ms 1 /src/Adapter/EntityMapper.php:79
893
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.237 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
368
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:806
35
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.235 ms 1 /classes/Language.php:883
388
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24133
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.235 ms 0 /classes/Product.php:1732
306
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
867
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 65907 LIMIT 1
0.235 ms 1 /classes/Product.php:1106
470
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24144
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.233 ms 0 /classes/Product.php:1732
509
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund` gf
WHERE (gf.shop_id=1) AND (gf.sent= "0") LIMIT 1
0.233 ms 1 /modules/ganalyticspro/models/orderRefund.php:105
466
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.233 ms 1 /classes/stock/StockAvailable.php:753
91
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.232 ms 1 /classes/stock/StockAvailable.php:453
132
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24129
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
189
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24136
AND image_shop.`cover` = 1 LIMIT 1
0.231 ms 1 /classes/Product.php:3570
218
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.231 ms 1 /classes/Product.php:5655
396
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24134
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.230 ms 0 /classes/Product.php:1732
903
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 65907 LIMIT 1
0.229 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
356
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24129 LIMIT 1
0.228 ms 1 /classes/Product.php:1106
439
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24140 LIMIT 1
0.228 ms 1 /classes/Product.php:1106
547
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7892
AND `id_shop` = 1 LIMIT 1
0.228 ms 1 /classes/Category.php:2450
464
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24143
0.227 ms 1 /classes/Tag.php:244
96
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8118 LIMIT 1
0.227 ms 1 /classes/Product.php:5655
272
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24145
AND image_shop.`cover` = 1 LIMIT 1
0.227 ms 1 /classes/Product.php:3570
495
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24147 LIMIT 1
0.227 ms 1 /classes/Product.php:1106
323
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24124 LIMIT 1
0.226 ms 1 /classes/Product.php:1106
849
SELECT SQL_NO_CACHE state FROM uag_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.226 ms 1 /classes/FeatureFlag.php:105
53
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8121) AND (b.`id_shop` = 1) LIMIT 1
0.225 ms 1 /src/Adapter/EntityMapper.php:71
69
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 10
0.225 ms 1 /src/Adapter/EntityMapper.php:79
111
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24126) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.225 ms 1 /classes/stock/StockAvailable.php:453
128
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24128 AND `id_group` = 1 LIMIT 1
0.225 ms 0 /classes/GroupReduction.php:156
244
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24142
AND image_shop.`cover` = 1 LIMIT 1
0.224 ms 1 /classes/Product.php:3570
310
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24123 AND `id_shop` = 1
0.224 ms 1 /src/Adapter/EntityMapper.php:79
485
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24146 AND `id_shop` = 1
0.223 ms 1 /src/Adapter/EntityMapper.php:79
879
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.223 ms 1 /classes/module/Module.php:2109
116
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24127 LIMIT 1
0.223 ms 1 /classes/SpecificPrice.php:435
341
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24127
0.223 ms 1 /classes/Tag.php:244
68
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.222 ms 1 /src/Adapter/EntityMapper.php:71
397
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24134 LIMIT 1
0.222 ms 1 /classes/Product.php:1106
398
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24134
0.222 ms 1 /classes/Tag.php:244
389
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24133 LIMIT 1
0.221 ms 1 /classes/Product.php:1106
163
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24132 LIMIT 1
0.220 ms 1 /classes/SpecificPrice.php:435
86
SELECT SQL_NO_CACHE *
FROM `uag_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.220 ms 1 /src/Adapter/EntityMapper.php:71
891
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715170757
0.218 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
458
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.217 ms 1 /classes/stock/StockAvailable.php:753
165
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24132 AND id_shop=1 LIMIT 1
0.217 ms 1 /classes/Product.php:6870
355
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24129
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.217 ms 0 /classes/Product.php:1732
390
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24133
0.217 ms 1 /classes/Tag.php:244
469
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24144 AND `id_shop` = 1
0.217 ms 1 /src/Adapter/EntityMapper.php:79
496
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24147
0.216 ms 1 /classes/Tag.php:244
138
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.215 ms 1 /classes/stock/StockAvailable.php:453
107
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24126 LIMIT 1
0.214 ms 1 /classes/SpecificPrice.php:435
420
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24138 AND `id_shop` = 1
0.213 ms 1 /src/Adapter/EntityMapper.php:79
530
SELECT SQL_NO_CACHE id_feed
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.213 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:75
382
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.212 ms 1 /classes/stock/StockAvailable.php:778
471
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24144 LIMIT 1
0.212 ms 1 /classes/Product.php:1106
477
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24145 AND `id_shop` = 1
0.211 ms 1 /src/Adapter/EntityMapper.php:79
860
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8120 AND `id_shop` = 1
0.211 ms 1 /src/Adapter/EntityMapper.php:79
208
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 24138
AND image_shop.`cover` = 1 LIMIT 1
0.210 ms 1 /classes/Product.php:3570
900
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c LEFT JOIN uag_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 7892 AND s.id_shop = 1 LIMIT 1
0.209 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
371
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24131
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.209 ms 0 /classes/Product.php:1732
232
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.208 ms 1 /classes/stock/StockAvailable.php:453
339
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24127
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.208 ms 0 /classes/Product.php:1732
278
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.207 ms 1 /classes/stock/StockAvailable.php:453
118
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24127 AND id_shop=1 LIMIT 1
0.207 ms 1 /classes/Product.php:6870
105
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8119 LIMIT 1
0.206 ms 1 /classes/Category.php:1378
418
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:806
457
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.206 ms 1 /classes/stock/StockAvailable.php:778
478
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24145
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.206 ms 0 /classes/Product.php:1732
67
SELECT SQL_NO_CACHE *
FROM `uag_state` a
WHERE (a.`id_state` = 234) LIMIT 1
0.205 ms 1 /src/Adapter/EntityMapper.php:71
924
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.205 ms 1 /classes/module/Module.php:2109
63
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.205 ms 0 /classes/module/Module.php:2109
36
SELECT SQL_NO_CACHE value FROM `uag_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.204 ms 1 /classes/shop/Shop.php:1183
346
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24128 AND `id_shop` = 1
0.204 ms 1 /src/Adapter/EntityMapper.php:79
364
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24130 LIMIT 1
0.203 ms 1 /classes/Product.php:1106
362
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24130 AND `id_shop` = 1
0.203 ms 1 /src/Adapter/EntityMapper.php:79
351
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24128) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:753
379
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24132
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.201 ms 0 /classes/Product.php:1732
507
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.201 ms 1 /classes/stock/StockAvailable.php:806
97
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24124 LIMIT 1
0.200 ms 1 /classes/SpecificPrice.php:435
157
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.200 ms 1 /classes/stock/StockAvailable.php:453
465
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.200 ms 1 /classes/stock/StockAvailable.php:778
292
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24147 LIMIT 1
0.199 ms 1 /classes/SpecificPrice.php:435
350
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24128) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:778
90
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.199 ms 0 /classes/tax/TaxRulesTaxManager.php:109
435
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.198 ms 1 /classes/stock/StockAvailable.php:806
125
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24128 LIMIT 1
0.197 ms 1 /classes/SpecificPrice.php:435
906
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 65907)
GROUP BY a0.`id_supplier`
0.197 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
155
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24131 AND id_shop=1 LIMIT 1
0.197 ms 1 /classes/Product.php:6870
329
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24126 AND `id_shop` = 1
0.197 ms 1 /src/Adapter/EntityMapper.php:79
878
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.197 ms 1 /classes/module/Module.php:2636
437
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24140 AND `id_shop` = 1
0.196 ms 1 /src/Adapter/EntityMapper.php:79
381
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24132
0.196 ms 1 /classes/Tag.php:244
874
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.196 ms 1 /classes/module/Module.php:2636
305
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24148 AND `id_group` = 1 LIMIT 1
0.195 ms 0 /classes/GroupReduction.php:156
403
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24136 AND `id_shop` = 1
0.195 ms 1 /src/Adapter/EntityMapper.php:79
28
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.194 ms 1 /modules/ps_mbo/ps_mbo.php:325
47
SELECT SQL_NO_CACHE ctg.`id_group`
FROM uag_category_group ctg
WHERE ctg.`id_category` = 7892 AND ctg.`id_group` = 1 LIMIT 1
0.194 ms 1 /classes/Category.php:1754
115
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.194 ms 1 /classes/Product.php:5655
392
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.194 ms 1 /classes/stock/StockAvailable.php:753
895
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1
0.194 ms 1 /classes/module/Module.php:2109
324
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24124
0.193 ms 1 /classes/Tag.php:244
214
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.191 ms 1 /classes/stock/StockAvailable.php:453
291
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.191 ms 1 /classes/Product.php:5655
512
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ybc_blog" LIMIT 1
0.191 ms 1 /classes/module/Module.php:2636
877
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.191 ms 1 /classes/module/Module.php:2109
146
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24130 AND id_shop=1 LIMIT 1
0.190 ms 1 /classes/Product.php:6870
166
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24132 AND `id_group` = 1 LIMIT 1
0.189 ms 0 /classes/GroupReduction.php:156
441
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:778
535
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.189 ms 1 /classes/Currency.php:893
864
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7842 AND `id_shop` = 1
0.189 ms 1 /src/Adapter/EntityMapper.php:79
31
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.189 ms 1 /modules/ps_mbo/ps_mbo.php:335
510
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund_partial` grf
WHERE (grf.shop_id=1) AND (grf.sent= "0") LIMIT 1
0.189 ms 1 /modules/ganalyticspro/models/orderPartialRefund.php:105
259
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.188 ms 1 /classes/stock/StockAvailable.php:453
373
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24131
0.187 ms 1 /classes/Tag.php:244
44
SELECT SQL_NO_CACHE *
FROM `uag_group_lang`
WHERE `id_group` = 1
0.187 ms 1 /src/Adapter/EntityMapper.php:79
101
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.187 ms 1 /classes/stock/StockAvailable.php:453
319
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8118 LIMIT 1
0.187 ms 0 /classes/Category.php:1378
404
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24136
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.187 ms 0 /classes/Product.php:1732
406
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24136
0.187 ms 1 /classes/Tag.php:244
446
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24141
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.187 ms 0 /classes/Product.php:1732
483
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.187 ms 1 /classes/stock/StockAvailable.php:806
205
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:453
370
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24131 AND `id_shop` = 1
0.186 ms 1 /src/Adapter/EntityMapper.php:79
459
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:806
440
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24140
0.185 ms 1 /classes/Tag.php:244
513
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 120 AND `id_shop` = 1 LIMIT 1
0.185 ms 1 /classes/module/Module.php:2109
931
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 3) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.185 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
287
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:453
312
SELECT SQL_NO_CACHE `name` FROM `uag_supplier` WHERE `id_supplier` = 0 LIMIT 1
0.184 ms 0 /classes/Supplier.php:243
7
SELECT SQL_NO_CACHE *
FROM `uag_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.183 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24146
0.183 ms 1 /classes/Tag.php:244
917
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 65907 AND `id_group` = 0 LIMIT 1
0.182 ms 0 /classes/GroupReduction.php:156
311
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 37777
AND `active` = 1 LIMIT 1
0.182 ms 1 /classes/Manufacturer.php:316
431
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24139 LIMIT 1
0.182 ms 1 /classes/Product.php:1106
401
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:806
504
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24148
0.181 ms 1 /classes/Tag.php:244
848
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 65907
0.181 ms 1 /classes/Product.php:2902
120
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24127) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.180 ms 1 /classes/stock/StockAvailable.php:453
472
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24144
0.180 ms 1 /classes/Tag.php:244
479
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24145 LIMIT 1
0.180 ms 1 /classes/Product.php:1106
497
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.180 ms 1 /classes/stock/StockAvailable.php:778
868
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7892 LIMIT 1
0.180 ms 1 /classes/Category.php:1585
171
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8120 LIMIT 1
0.179 ms 1 /classes/Product.php:5655
201
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24137 LIMIT 1
0.179 ms 1 /classes/SpecificPrice.php:435
263
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.179 ms 1 /classes/Product.php:5655
520
SELECT SQL_NO_CACHE * FROM `uag_image_type`
0.179 ms 8 /classes/ImageType.php:161
839
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 65907 LIMIT 1
0.179 ms 1 /classes/SpecificPrice.php:435
880
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.179 ms 1 /classes/module/Module.php:2636
70
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM uag_required_field
0.178 ms 1 /classes/ObjectModel.php:1592
482
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:753
301
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8150 LIMIT 1
0.178 ms 1 /classes/Product.php:5655
182
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24134 LIMIT 1
0.177 ms 1 /classes/SpecificPrice.php:435
167
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:453
433
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.177 ms 1 /classes/stock/StockAvailable.php:778
910
SELECT SQL_NO_CACHE `id_zone`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.176 ms 1 /classes/Country.php:224
219
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24139 LIMIT 1
0.176 ms 1 /classes/SpecificPrice.php:435
304
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24148 AND id_shop=1 LIMIT 1
0.176 ms 1 /classes/Product.php:6870
136
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24129 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6870
412
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24137 AND `id_shop` = 1
0.174 ms 1 /src/Adapter/EntityMapper.php:79
434
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:753
932
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 4) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.174 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
937
SELECT SQL_NO_CACHE id_page_type
FROM uag_page_type
WHERE name = 'category' LIMIT 1
0.174 ms 1 /classes/Page.php:104
399
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:778
843
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 65907) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:453
30
SELECT SQL_NO_CACHE `active`
FROM `uag_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.173 ms 1 /modules/ps_mbo/ps_mbo.php:325
209
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.173 ms 1 /classes/Product.php:5655
487
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24146 LIMIT 1
0.173 ms 1 /classes/Product.php:1106
29
SELECT SQL_NO_CACHE m.`id_module` as `active`, ms.`id_module` as `shop_active`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
WHERE `name` = "ps_mbo" LIMIT 1
0.172 ms 1 /modules/ps_mbo/ps_mbo.php:335
318
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.172 ms 1 /classes/stock/StockAvailable.php:806
837
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8120 LIMIT 1
0.172 ms 1 /classes/Product.php:5655
881
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.171 ms 1 /classes/module/Module.php:2109
317
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24123) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.171 ms 1 /classes/stock/StockAvailable.php:753
508
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8150 LIMIT 1
0.171 ms 0 /classes/Category.php:1378
546
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 130 AND `id_shop` = 1 LIMIT 1
0.171 ms 1 /classes/module/Module.php:2109
863
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7842) LIMIT 1
0.171 ms 1 /src/Adapter/EntityMapper.php:71
422
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24138
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.170 ms 0 /classes/Product.php:1732
124
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.169 ms 1 /classes/Product.php:5655
194
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24136 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6870
358
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.169 ms 1 /classes/stock/StockAvailable.php:778
372
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24131 LIMIT 1
0.169 ms 1 /classes/Product.php:1106
908
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 65907
0.169 ms 3 /classes/Product.php:3423
257
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24143 AND id_shop=1 LIMIT 1
0.169 ms 1 /classes/Product.php:6870
375
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.168 ms 1 /classes/stock/StockAvailable.php:753
176
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24133) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.167 ms 1 /classes/stock/StockAvailable.php:453
536
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.167 ms 1 /classes/Country.php:194
87
SELECT SQL_NO_CACHE *
FROM `uag_tax_lang`
WHERE `id_tax` = 1
0.165 ms 1 /src/Adapter/EntityMapper.php:79
348
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24128 LIMIT 1
0.165 ms 1 /classes/Product.php:1106
415
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24137
0.165 ms 1 /classes/Tag.php:244
285
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24146 AND id_shop=1 LIMIT 1
0.164 ms 1 /classes/Product.php:6870
424
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24138
0.164 ms 1 /classes/Tag.php:244
250
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24142) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:453
347
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24128
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.163 ms 0 /classes/Product.php:1732
853
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7892 LIMIT 1
0.163 ms 1 /classes/Category.php:1585
407
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:778
481
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24145) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:778
227
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.162 ms 1 /classes/Product.php:5655
838
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 46270
AND `active` = 1 LIMIT 1
0.162 ms 1 /classes/Manufacturer.php:316
109
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24126 AND id_shop=1 LIMIT 1
0.161 ms 1 /classes/Product.php:6870
414
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24137 LIMIT 1
0.161 ms 1 /classes/Product.php:1106
498
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.161 ms 1 /classes/stock/StockAvailable.php:753
872
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.161 ms 1 /classes/module/Module.php:2109
172
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24133 LIMIT 1
0.160 ms 1 /classes/SpecificPrice.php:435
190
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8121 LIMIT 1
0.160 ms 1 /classes/Category.php:1378
344
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24127) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.160 ms 1 /classes/stock/StockAvailable.php:806
862
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.160 ms 1 /src/Adapter/EntityMapper.php:79
180
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8120 LIMIT 1
0.159 ms 1 /classes/Product.php:5655
330
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 24126
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.159 ms 0 /classes/Product.php:1732
343
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24127) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.158 ms 1 /classes/stock/StockAvailable.php:753
37
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.158 ms 1 /classes/Currency.php:893
473
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.158 ms 1 /classes/stock/StockAvailable.php:778
78
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8118 LIMIT 1
0.157 ms 1 /classes/Product.php:5655
134
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24129 LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:435
147
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24130 AND `id_group` = 1 LIMIT 1
0.156 ms 0 /classes/GroupReduction.php:156
467
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24143) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.156 ms 1 /classes/stock/StockAvailable.php:806
223
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.155 ms 1 /classes/stock/StockAvailable.php:453
447
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24141 LIMIT 1
0.155 ms 1 /classes/Product.php:1106
265
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24144 LIMIT 1
0.154 ms 1 /classes/SpecificPrice.php:435
248
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24142 AND id_shop=1 LIMIT 1
0.154 ms 1 /classes/Product.php:6870
274
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24145 LIMIT 1
0.153 ms 1 /classes/SpecificPrice.php:435
338
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24127 AND `id_shop` = 1
0.153 ms 1 /src/Adapter/EntityMapper.php:79
449
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.153 ms 1 /classes/stock/StockAvailable.php:778
861
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.153 ms 1 /src/Adapter/EntityMapper.php:71
352
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24128) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:806
367
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.152 ms 1 /classes/stock/StockAvailable.php:753
905
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 65907 LIMIT 1
0.151 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
99
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24124 AND id_shop=1 LIMIT 1
0.150 ms 1 /classes/Product.php:6870
445
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 24141 AND `id_shop` = 1
0.150 ms 1 /src/Adapter/EntityMapper.php:79
491
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:806
137
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24129 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
255
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24143 LIMIT 1
0.149 ms 1 /classes/SpecificPrice.php:435
334
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24126) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:753
385
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8120 LIMIT 1
0.149 ms 0 /classes/Category.php:1378
410
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8121 LIMIT 1
0.149 ms 0 /classes/Category.php:1378
416
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.149 ms 1 /classes/stock/StockAvailable.php:778
534
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 10 LIMIT 1
0.149 ms 1 /classes/Country.php:252
883
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.149 ms 1 /classes/module/Module.php:2109
119
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24127 AND `id_group` = 1 LIMIT 1
0.149 ms 0 /classes/GroupReduction.php:156
327
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:806
331
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24126 LIMIT 1
0.148 ms 1 /classes/Product.php:1106
210
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24138 LIMIT 1
0.148 ms 1 /classes/SpecificPrice.php:435
236
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.148 ms 1 /classes/Product.php:5655
254
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.148 ms 1 /classes/Product.php:5655
505
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:778
79
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 0 LIMIT 1
0.147 ms 1 /classes/SpecificPrice.php:426
100
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24124 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
296
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:453
77
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8118 LIMIT 1
0.146 ms 1 /classes/Category.php:1378
349
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24128
0.146 ms 1 /classes/Tag.php:244
902
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1
0.146 ms 1 /classes/module/Module.php:2109
192
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24136 LIMIT 1
0.145 ms 1 /classes/SpecificPrice.php:435
230
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24140 AND id_shop=1 LIMIT 1
0.145 ms 1 /classes/Product.php:6870
336
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8119 LIMIT 1
0.145 ms 0 /classes/Category.php:1378
286
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24146 AND `id_group` = 1 LIMIT 1
0.143 ms 0 /classes/GroupReduction.php:156
541
SELECT SQL_NO_CACHE * FROM uag_module_shop WHERE id_module = 109 AND id_shop = 1
0.143 ms 1 /modules/gremarketing/lib/moduleTools.php:403
196
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:453
384
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24132) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.142 ms 1 /classes/stock/StockAvailable.php:806
894
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.142 ms 1 /classes/module/Module.php:2636
42
SELECT SQL_NO_CACHE id_shop
FROM `uag_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.141 ms 1 /classes/ObjectModel.php:1729
200
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8121 LIMIT 1
0.141 ms 1 /classes/Product.php:5655
366
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24130) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:778
475
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.141 ms 1 /classes/stock/StockAvailable.php:806
283
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24146 LIMIT 1
0.141 ms 1 /classes/SpecificPrice.php:435
186
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:453
88
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24123 AND `id_group` = 1 LIMIT 1
0.140 ms 0 /classes/GroupReduction.php:156
326
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24124) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:753
277
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24145 AND `id_group` = 1 LIMIT 1
0.139 ms 0 /classes/GroupReduction.php:156
443
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:806
506
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24148) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:753
142
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.136 ms 1 /classes/Product.php:5655
499
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24147) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.136 ms 1 /classes/stock/StockAvailable.php:806
9
SELECT SQL_NO_CACHE id_shop
FROM `uag_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.135 ms 1 /classes/ObjectModel.php:1729
340
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24127 LIMIT 1
0.135 ms 1 /classes/Product.php:1106
89
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 1 LIMIT 1
0.134 ms 1 /classes/Group.php:154
204
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24137 AND `id_group` = 1 LIMIT 1
0.134 ms 0 /classes/GroupReduction.php:156
400
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24134) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:753
332
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=24126
0.133 ms 1 /classes/Tag.php:244
518
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.133 ms 0 /classes/module/Module.php:2636
267
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24144 AND id_shop=1 LIMIT 1
0.132 ms 1 /classes/Product.php:6870
423
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 24138 LIMIT 1
0.131 ms 1 /classes/Product.php:1106
537
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.131 ms 1 /classes/Country.php:252
540
SELECT SQL_NO_CACHE id_module as id, active FROM uag_module WHERE name = "gmerchantcenterpro" AND active = 1
0.131 ms 1 /modules/gremarketing/lib/moduleTools.php:398
174
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24133 AND id_shop=1 LIMIT 1
0.131 ms 1 /classes/Product.php:6870
360
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:806
374
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:778
876
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.131 ms 1 /classes/module/Module.php:2636
376
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24131) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.130 ms 1 /classes/stock/StockAvailable.php:806
489
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.130 ms 1 /classes/stock/StockAvailable.php:778
221
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24139 AND id_shop=1 LIMIT 1
0.129 ms 1 /classes/Product.php:6870
246
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24142 LIMIT 1
0.128 ms 1 /classes/SpecificPrice.php:435
490
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24146) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.128 ms 1 /classes/stock/StockAvailable.php:753
269
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.127 ms 1 /classes/stock/StockAvailable.php:453
417
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.126 ms 1 /classes/stock/StockAvailable.php:753
294
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24147 AND id_shop=1 LIMIT 1
0.125 ms 1 /classes/Product.php:6870
273
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.124 ms 1 /classes/Product.php:5655
45
SELECT SQL_NO_CACHE id_shop
FROM `uag_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.122 ms 1 /classes/ObjectModel.php:1729
110
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24126 AND `id_group` = 1 LIMIT 1
0.122 ms 0 /classes/GroupReduction.php:156
240
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24141 AND `id_group` = 1 LIMIT 1
0.122 ms 0 /classes/GroupReduction.php:156
276
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24145 AND id_shop=1 LIMIT 1
0.122 ms 1 /classes/Product.php:6870
529
COMMIT
0.122 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:100
203
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24137 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6870
342
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24127) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:778
539
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 19
0.121 ms 1 /src/Adapter/EntityMapper.php:79
425
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.121 ms 1 /classes/stock/StockAvailable.php:778
175
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24133 AND `id_group` = 1 LIMIT 1
0.120 ms 0 /classes/GroupReduction.php:156
185
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24134 AND `id_group` = 1 LIMIT 1
0.118 ms 0 /classes/GroupReduction.php:156
451
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.118 ms 1 /classes/stock/StockAvailable.php:806
875
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.118 ms 1 /classes/module/Module.php:2109
899
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.118 ms 1 /classes/module/Module.php:2109
245
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.118 ms 1 /classes/Product.php:5655
191
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8121 LIMIT 1
0.117 ms 1 /classes/Product.php:5655
258
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24143 AND `id_group` = 1 LIMIT 1
0.117 ms 0 /classes/GroupReduction.php:156
133
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.115 ms 1 /classes/Product.php:5655
474
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24144) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.115 ms 1 /classes/stock/StockAvailable.php:753
241
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 24141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.115 ms 1 /classes/stock/StockAvailable.php:453
442
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24140) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.115 ms 1 /classes/stock/StockAvailable.php:753
841
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 65907 AND id_shop=1 LIMIT 1
0.115 ms 1 /classes/Product.php:6870
282
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.114 ms 1 /classes/Product.php:5655
335
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24126) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.114 ms 1 /classes/stock/StockAvailable.php:806
918
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 0 LIMIT 1
0.114 ms 0 /classes/Group.php:154
359
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24129) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.113 ms 1 /classes/stock/StockAvailable.php:753
450
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24141) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.113 ms 1 /classes/stock/StockAvailable.php:753
854
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.113 ms 1 /classes/Category.php:1591
333
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 24126) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.112 ms 1 /classes/stock/StockAvailable.php:778
523
CREATE TABLE IF NOT EXISTS `uag_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.112 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
885
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.112 ms 1 /classes/module/Module.php:2109
156
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24131 AND `id_group` = 1 LIMIT 1
0.111 ms 0 /classes/GroupReduction.php:156
212
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24138 AND id_shop=1 LIMIT 1
0.110 ms 1 /classes/Product.php:6870
222
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24139 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
421
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28397
AND `active` = 1 LIMIT 1
0.109 ms 1 /classes/Manufacturer.php:316
184
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24134 AND id_shop=1 LIMIT 1
0.107 ms 1 /classes/Product.php:6870
195
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24136 AND `id_group` = 1 LIMIT 1
0.106 ms 0 /classes/GroupReduction.php:156
249
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24142 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:156
295
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24147 AND `id_group` = 1 LIMIT 1
0.105 ms 0 /classes/GroupReduction.php:156
897
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.105 ms 1 /classes/module/Module.php:2109
869
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.103 ms 1 /classes/Category.php:1591
521
BEGIN
0.101 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:74
213
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24138 AND `id_group` = 1 LIMIT 1
0.100 ms 0 /classes/GroupReduction.php:156
80
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 24123 LIMIT 1
0.098 ms 1 /classes/SpecificPrice.php:435
106
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8119 LIMIT 1
0.098 ms 1 /classes/Product.php:5655
408
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.096 ms 1 /classes/stock/StockAvailable.php:753
239
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 24141 AND id_shop=1 LIMIT 1
0.095 ms 1 /classes/Product.php:6870
542
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenter" LIMIT 1
0.091 ms 0 /classes/module/Module.php:2636
427
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.090 ms 1 /classes/stock/StockAvailable.php:806
268
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 24144 AND `id_group` = 1 LIMIT 1
0.089 ms 0 /classes/GroupReduction.php:156
526
CREATE TABLE IF NOT EXISTS `uag_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.089 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
409
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 24136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.088 ms 1 /classes/stock/StockAvailable.php:806
519
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.086 ms 0 /classes/module/Module.php:2636
426
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 24138) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.079 ms 1 /classes/stock/StockAvailable.php:753
524
CREATE TABLE IF NOT EXISTS `uag_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.063 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
527
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.062 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
528
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.054 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
525
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.050 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72

Doubles

266 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=XX)) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value=XX)) GROUP BY fp.id_feature_value
26 queries
SELECT XX FROM `uag_specific_price` WHERE id_product = XX LIMIT XX
26 queries
			SELECT `reduction`
			FROM `uag_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
25 queries
SELECT image_shop.`id_image`
                    FROM `uag_image` i
                     INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
25 queries
SELECT name FROM uag_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
25 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
25 queries
                            SELECT `id_tax_rules_group`
                            FROM `uag_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
25 queries
SELECT SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
25 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `uag_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
25 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM uag_feature_product pf
                LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN uag_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
25 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
25 queries
SELECT *
							FROM `uag_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
25 queries
SELECT product_attribute_shop.id_product_attribute
                FROM uag_product_attribute pa
                 INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT COUNT(p.id_product)
            FROM `uag_product` p
             INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
            WHERE p.id_product = XX
            AND DATEDIFF("XX-XX-XX XX:XX:XX", product_shop.`date_add`) < XX LIMIT XX
24 queries
        SELECT t.`id_lang`, t.`name`
        FROM uag_tag t
        LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
        WHERE pt.`id_product`=XX
24 queries
SELECT out_of_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
17 queries
SELECT `id_module` FROM `uag_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
10 queries
			SELECT cl.`link_rewrite`
			FROM `uag_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
9 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
6 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `uag_module` m
                LEFT JOIN `uag_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
5 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
5 queries
SELECT *
							FROM `uag_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
5 queries
SELECT a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = XX)
WHERE (a.`id_lgcookieslaw_purpose` = XX) AND (a.`id_shop` = XX) AND (a.`active` = XX)
ORDER BY a.`name`
4 queries
				SELECT tr.*
				FROM `uag_tax_rule` tr
				JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
4 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
4 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries
				SELECT `name`
				FROM `uag_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries
SELECT id_manufacturer FROM `uag_product` WHERE id_product = XX LIMIT XX
3 queries
SELECT *
FROM `uag_product_supplier` aXX
WHERE (aXX.`id_product` = XX)
GROUP BY aXX.`id_supplier`
3 queries
                 SELECT gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "XX-XX-XX XX:XX:XX" OR date_from = "XX-XX-XX XX:XX:XX") AND (date_to >= "XX-XX-XX XX:XX:XX" OR date_to = "XX-XX-XX XX:XX:XX") AND gi.`id_shop` = XX AND gi.`active` = XX  AND (gi.groups = ""  OR FIND_IN_SET(XX, REPLACE(gi.groups, ";", ",")) > XX) AND (gi.manufacturers = "" OR FIND_IN_SET(XX, REPLACE(gi.manufacturers, ";", ",")) > XX) AND (gi.suppliers = "" ) ORDER BY position, priority
2 queries
SELECT s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = XX
 INNER JOIN uag_supplier_shop supplier_shop
        ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = XX)
WHERE (s.`active` = XX)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
2 queries
SELECT `active`
        FROM `uag_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT m.`id_module` as `active`, ms.`id_module` as `shop_active`
        FROM `uag_module` m
        LEFT JOIN `uag_module_shop` ms ON m.`id_module` = ms.`id_module`
        WHERE `name` = "ps_mbo" LIMIT XX
2 queries
SELECT `id_lang` FROM `uag_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `uag_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `uag_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `uag_country_lang`
							WHERE `id_country` = XX
2 queries
SELECT a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = XX)
WHERE (a.`id_shop` = XX) AND (a.`active` = XX)
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, XX) AS id_product_attribute,
					product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
					pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
					il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
					DATEDIFF(product_shop.`date_add`, DATE_SUB("XX-XX-XX XX:XX:XX",
					INTERVAL XX DAY)) > XX AS new, product_shop.price AS orderprice
				FROM `uag_category_product` cp
				LEFT JOIN `uag_product` p
					ON p.`id_product` = cp.`id_product`
				 INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
				ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = XX AND product_attribute_shop.id_shop=XX)
				 LEFT JOIN uag_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = XX AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
				LEFT JOIN `uag_category_lang` cl
					ON (product_shop.`id_category_default` = cl.`id_category`
					AND cl.`id_lang` = XX AND cl.id_shop = XX )
				LEFT JOIN `uag_product_lang` pl
					ON (p.`id_product` = pl.`id_product`
					AND pl.`id_lang` = XX AND pl.id_shop = XX )
				LEFT JOIN `uag_image_shop` image_shop
					ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=XX AND image_shop.id_shop=XX)
				LEFT JOIN `uag_image_lang` il
					ON (image_shop.`id_image` = il.`id_image`
					AND il.`id_lang` = XX)
				LEFT JOIN `uag_manufacturer` m
					ON m.`id_manufacturer` = p.`id_manufacturer`
				WHERE product_shop.`id_shop` = XX
					AND cp.`id_category` = XX AND product_shop.`active` = XX AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
			LIMIT XX,XX
2 queries
			SELECT `reduction`
			FROM `uag_group`
			WHERE `id_group` = XX LIMIT XX
2 queries
							SELECT `name`
							FROM `uag_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright`  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright` FROM `uag_category` c
            WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.*, cl.*  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
2 queries
DELETE FROM `uag_feedaty_cache` WHERE expiration < XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_widgets" LIMIT XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_analytics" LIMIT XX

Tables stress

839 feature_product
385 product
382 product_shop
378 stock_available
304 product_attribute
301 category
280 category_product
279 category_group
278 product_attribute_combination
274 product_sale
60 category_lang
53 product_attribute_shop
51 cart_product
36 module
33 product_lang
29 feature_value_lang
28 image_shop
27 module_shop
27 feature
27 feature_shop
27 feature_lang
26 image
26 specific_price
26 product_group_reduction_cache
25 pack
24 tag
24 product_tag
19 category_shop
7 country
7 hook
6 currency
6 manufacturer
6 feedaty_cache
5 lang
5 country_lang
5 group
5 feature_value
5 lgcookieslaw_cookie
5 lgcookieslaw_cookie_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 tax_rule
4 tax_rules_group
4 layered_indexable_feature_value_lang_value
4 multipleprices_configuration
3 country_shop
3 hook_alias
3 supplier
3 group_lang
3 group_shop
3 image_lang
3 gmcp_feeds
3 product_supplier
2 shop_group
2 configuration
2 hook_module
2 supplier_lang
2 supplier_shop
2 currency_lang
2 cart_rule_lang
2 image_type
2 lgcookieslaw_purpose
2 lgcookieslaw_purpose_lang
2 iqit_elementor_category
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 revslider_sliders
1 tax
1 tax_lang
1 gap_refund
1 gap_refund_partial
1 ets_abancart_campaign
1 ets_abancart_campaign_country
1 ets_abancart_campaign_with_lang
1 ets_abancart_campaign_group
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 feature_flag
1 iqit_elementor_category_shop
1 iqitreviews_products
1 attribute
1 attribute_lang
1 attribute_group
1 multipleprices_configuration_lang
1 ybc_blog_post
1 ybc_blog_post_shop
1 ybc_blog_post_lang
1 ybc_blog_post_category
1 ybc_blog_post_related_categories
1 customer
1 employee
1 ybc_blog_employee
1 ybc_blog_comment
1 cms
1 cms_lang
1 cms_shop
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Category 58 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 7892]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8117]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8118]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8119]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8120]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8121]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8150]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8181]
/classes/Meta.php:380 (__construct) [id: 7892]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ganalyticspro/lib/gtag/categoryTag.php:33 (__construct) [id: 7892]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7892]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8118]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8118]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8120]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8120]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8120]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8121]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8121]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8119]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8150]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7892]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:64 (__construct) [id: 7892]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:171 (__construct) [id: 7892]
/modules/connettore/connettore.php:490 (__construct) [id: 7892]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 7892]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8120]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1338 (__construct) [id: 2]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7892]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 7892]
Product 34 /classes/Link.php:113 (__construct) [id: 24130]
/classes/Link.php:113 (__construct) [id: 24134]
/classes/Link.php:113 (__construct) [id: 24144]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24123]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24124]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24126]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24127]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24128]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24129]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24130]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24131]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24132]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24133]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24134]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24136]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24137]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24138]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24139]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24140]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24141]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24142]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24143]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24144]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24145]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24146]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24147]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 24148]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 65907]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 65907]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 65907]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 65907]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 65907]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 65907]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 65907]
Address 34 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5958 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
Cart 7 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Language 6 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/ganalyticspro/lib/gtag/categoryTag.php:52 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:139 (__construct) [id: 1]
Country 6 /config/config.inc.php:146 (__construct) [id: 10]
/classes/controller/FrontController.php:354 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1767 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 19]
Configuration 5 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 5 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
OrderState 5 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:695 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:211 (__construct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 234]
/classes/controller/FrontController.php:1766 (__construct) [id: 234]
Group 2 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:370 (__construct) [id: 1]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
MultiplepricesConfiguration 1 /modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
CMS 1 /classes/Link.php:555 (__construct) [id: 3]
AddressFormat 1 /classes/controller/FrontController.php:1761 (generateAddress) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1694 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1691 (__construct) [id: 0]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/ircmaxell/password-compat/lib/password.php
40 /vendor/api-platform/core/src/deprecation.php
41 /vendor/api-platform/core/src/Api/FilterInterface.php
42 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
43 /vendor/api-platform/core/src/deprecated_interfaces.php
44 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
46 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
56 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
58 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
59 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
61 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
62 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
63 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
65 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
66 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
67 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
68 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
69 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
70 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
71 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
72 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
73 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
74 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
75 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
76 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
77 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
78 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
79 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
86 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
90 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
94 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
97 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
98 /vendor/psr/container/src/ContainerInterface.php
99 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/dev/appParameters.php
114 /var/cache/dev/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /override/classes/Configuration.php
134 /classes/Configuration.php
135 /classes/Validate.php
136 /classes/cache/Cache.php
137 /src/Adapter/EntityMapper.php
138 /classes/db/DbQuery.php
139 /src/Core/Addon/Theme/ThemeManagerBuilder.php
140 /vendor/psr/log/Psr/Log/NullLogger.php
141 /vendor/psr/log/Psr/Log/AbstractLogger.php
142 /vendor/psr/log/Psr/Log/LoggerInterface.php
143 /src/Adapter/Configuration.php
144 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
145 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
146 /src/Core/ConfigurationInterface.php
147 /src/Core/Addon/Theme/ThemeRepository.php
148 /src/Core/Addon/AddonRepositoryInterface.php
149 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
150 /src/Core/Addon/Theme/Theme.php
151 /src/Core/Addon/AddonInterface.php
152 /src/Core/Util/File/YamlParser.php
153 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
154 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
155 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
157 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
158 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
159 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
160 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
161 /var/cache/dev/yaml/84a464d0176e3f6031f8e8ec956aa9cf.php
162 /src/Core/Util/ArrayFinder.php
163 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
164 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
165 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
166 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
167 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
168 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
169 /config/defines_uri.inc.php
170 /classes/Language.php
171 /src/Core/Language/LanguageInterface.php
172 /classes/Country.php
173 /classes/PrestaShopCollection.php
174 /classes/shop/ShopGroup.php
175 /classes/Cookie.php
176 /classes/PhpEncryption.php
177 /classes/PhpEncryptionEngine.php
178 /vendor/defuse/php-encryption/src/Key.php
179 /vendor/defuse/php-encryption/src/Encoding.php
180 /vendor/defuse/php-encryption/src/Core.php
181 /src/Core/Session/SessionHandler.php
182 /src/Core/Session/SessionHandlerInterface.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
197 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
198 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
199 /config/smarty.config.inc.php
200 /classes/Smarty/SmartyDev.php
201 /vendor/smarty/smarty/libs/Smarty.class.php
202 /vendor/smarty/smarty/libs/functions.php
203 /vendor/smarty/smarty/libs/Autoloader.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
213 /config/smartyfront.config.inc.php
214 /classes/Smarty/SmartyResourceModule.php
215 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
217 /classes/Smarty/SmartyResourceParent.php
218 /classes/Smarty/SmartyLazyRegister.php
219 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
220 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
221 /classes/Customer.php
222 /classes/Group.php
223 /override/classes/Link.php
224 /classes/Link.php
225 /classes/shop/ShopUrl.php
226 /override/classes/Dispatcher.php
227 /classes/Dispatcher.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
232 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
233 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
234 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
235 /src/Adapter/SymfonyContainer.php
236 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
237 /config/db_slave_server.inc.php
238 /modules/doofinder/doofinder.php
239 /modules/doofinder/lib/dfTools.class.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
241 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
242 /classes/Translate.php
243 /modules/doofinder/translations/it.php
244 /src/PrestaShopBundle/Translation/TranslatorComponent.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
246 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
247 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
248 /vendor/symfony/contracts/Translation/TranslatorInterface.php
249 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
250 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
252 /src/PrestaShopBundle/Translation/TranslatorInterface.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
258 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
259 /vendor/symfony/contracts/Translation/TranslatorTrait.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
261 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
262 /var/cache/dev/translations/catalogue.it-IT.NXhscRe.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
264 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
266 /modules/ybc_blog/ybc_blog.php
267 /modules/ybc_blog/classes/ybc_blog_category_class.php
268 /modules/ybc_blog/classes/ybc_blog_post_class.php
269 /modules/ybc_blog/classes/ybc_blog_paggination_class.php
270 /modules/ybc_blog/classes/ybc_blog_comment_class.php
271 /modules/ybc_blog/classes/ybc_blog_reply_class.php
272 /modules/ybc_blog/classes/ybc_blog_polls_class.php
273 /modules/ybc_blog/classes/ybc_blog_slide_class.php
274 /modules/ybc_blog/classes/ybc_blog_gallery_class.php
275 /modules/ybc_blog/classes/ybc_blog_link_class.php
276 /modules/ybc_blog/classes/ybc_blog_employee_class.php
277 /modules/ybc_blog/classes/ybc_blog_email_template_class.php
278 /modules/ybc_blog/classes/ImportExport.php
279 /modules/ybc_blog/classes/ybc_browser.php
280 /modules/ybc_blog/ybc_blog_defines.php
281 /modules/ybc_blog/classes/ybc_chatgpt.php
282 /modules/ybc_blog/classes/ybc_chatgpt_message.php
283 /modules/ybc_blog/src/FormType/DescriptionType.php
284 /src/PrestaShopBundle/Form/Admin/Sell/Product/Description/DescriptionType.php
285 /src/PrestaShopBundle/Form/Admin/Type/TranslatorAwareType.php
286 /src/PrestaShopBundle/Form/Admin/Type/CommonAbstractType.php
287 /vendor/symfony/symfony/src/Symfony/Component/Form/AbstractType.php
288 /vendor/symfony/symfony/src/Symfony/Component/Form/FormTypeInterface.php
289 /modules/ybc_blog/translations/it.php
290 /modules/simpleimportproduct/simpleimportproduct.php
291 /modules/simpleimportproduct/classes/mpmTools.php
292 /modules/simpleimportproduct/translations/it.php
293 /classes/Supplier.php
294 /override/classes/Feature.php
295 /classes/Feature.php
296 /modules/ets_abandonedcart/ets_abandonedcart.php
297 /modules/ets_abandonedcart/classes/EtsAbancartCore.php
298 /modules/ets_abandonedcart/classes/EtsAbancartCache.php
299 /modules/ets_abandonedcart/classes/EtsAbancartValidate.php
300 /modules/ets_abandonedcart/classes/EtsAbancartTools.php
301 /modules/ets_abandonedcart/classes/EtsAbancartMail.php
302 /classes/Mail.php
303 /modules/ets_abandonedcart/classes/EtsAbancartIndex.php
304 /modules/ets_abandonedcart/classes/EtsAbancartIndexCustomer.php
305 /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php
306 /modules/ets_abandonedcart/classes/EtsAbancartReminder.php
307 /modules/ets_abandonedcart/classes/EtsAbancartEmailTemplate.php
308 /modules/ets_abandonedcart/classes/EtsAbancartTracking.php
309 /modules/ets_abandonedcart/classes/EtsAbancartDisplayTracking.php
310 /modules/ets_abandonedcart/classes/EtsAbancartReminderForm.php
311 /modules/ets_abandonedcart/classes/EtsAbancartQueue.php
312 /modules/ets_abandonedcart/classes/EtsAbancartShoppingCart.php
313 /modules/ets_abandonedcart/classes/EtsAbancartUnsubscribers.php
314 /modules/ets_abandonedcart/classes/EtsAbancartDefines.php
315 /modules/ets_abandonedcart/classes/EtsAbancartForm.php
316 /modules/ets_abandonedcart/classes/EtsAbancartFormSubmit.php
317 /modules/ets_abandonedcart/classes/EtsAbancartField.php
318 /modules/ets_abandonedcart/classes/EtsAbancartFieldValue.php
319 /modules/ets_abandonedcart/translations/it.php
320 /modules/ps_mbo/ps_mbo.php
321 /modules/ps_mbo/vendor/autoload.php
322 /modules/ps_mbo/vendor/composer/autoload_real.php
323 /modules/ps_mbo/vendor/composer/platform_check.php
324 /modules/ps_mbo/vendor/composer/autoload_static.php
325 /modules/ps_mbo/vendor/clue/stream-filter/src/functions_include.php
326 /modules/ps_mbo/vendor/clue/stream-filter/src/functions.php
327 /modules/ps_mbo/vendor/php-http/message/src/filters.php
328 /modules/ps_mbo/vendor/sentry/sentry/src/functions.php
329 /modules/ps_mbo/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
330 /modules/ps_mbo/vendor/symfony/string/Resources/functions.php
331 /modules/ps_mbo/bootstrap.php
332 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
333 /modules/ps_mbo/src/Traits/HaveTabs.php
334 /modules/ps_mbo/src/Traits/UseHooks.php
335 /modules/ps_mbo/src/Traits/Hooks/UseDisplayBackOfficeEmployeeMenu.php
336 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneOne.php
337 /modules/ps_mbo/src/Traits/HaveCdcComponent.php
338 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneTwo.php
339 /modules/ps_mbo/src/Traits/Hooks/UseDashboardZoneThree.php
340 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminThemesListAfter.php
341 /modules/ps_mbo/src/Traits/Hooks/UseDisplayDashboardTop.php
342 /modules/ps_mbo/src/Traits/Hooks/UseActionAdminControllerSetMedia.php
343 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeInstallModule.php
344 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAdminToolbarButtons.php
345 /modules/ps_mbo/src/Traits/Hooks/UseActionGetAlternativeSearchPanels.php
346 /modules/ps_mbo/src/Traits/Hooks/UseDisplayAdminAfterHeader.php
347 /modules/ps_mbo/src/Traits/Hooks/UseDisplayModuleConfigureExtraButtons.php
348 /modules/ps_mbo/src/Traits/Hooks/UseActionListModules.php
349 /modules/ps_mbo/src/Traits/Hooks/UseActionModuleRegisterHookAfter.php
350 /modules/ps_mbo/src/Traits/Hooks/UseDisplayEmptyModuleCategoryExtraMessage.php
351 /modules/ps_mbo/src/Traits/Hooks/UseActionDispatcherBefore.php
352 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectShopUrlUpdateAfter.php
353 /modules/ps_mbo/src/Traits/Hooks/UseActionGeneralPageSave.php
354 /modules/ps_mbo/src/Traits/Hooks/UseActionBeforeUpgradeModule.php
355 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeDeleteBefore.php
356 /modules/ps_mbo/src/Traits/Hooks/UseActionObjectEmployeeUpdateBefore.php
357 /modules/ps_mbo/src/Traits/HaveShopOnExternalService.php
358 /modules/ps_mbo/src/Tab/TabInterface.php
359 /src/PrestaShopBundle/Translation/DomainNormalizer.php
360 /src/Adapter/Localization/LegacyTranslator.php
361 /modules/ps_mbo/vendor/symfony/string/UnicodeString.php
362 /modules/ps_mbo/vendor/symfony/string/AbstractUnicodeString.php
363 /modules/ps_mbo/vendor/symfony/string/AbstractString.php
364 /controllers/front/listing/CategoryController.php
365 /classes/controller/ProductListingFrontController.php
366 /classes/controller/ProductPresentingFrontController.php
367 /classes/controller/FrontController.php
368 /src/Adapter/Presenter/Object/ObjectPresenter.php
369 /src/Adapter/Presenter/PresenterInterface.php
370 /src/Adapter/Presenter/Cart/CartPresenter.php
371 /src/Adapter/Product/PriceFormatter.php
372 /src/Adapter/Image/ImageRetriever.php
373 /classes/tax/TaxConfiguration.php
374 /classes/Smarty/TemplateFinder.php
375 /classes/assets/StylesheetManager.php
376 /classes/assets/AbstractAssetManager.php
377 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
378 /classes/assets/JavascriptManager.php
379 /classes/assets/CccReducer.php
380 /modules/iqitthemeeditor/iqitthemeeditor.php
381 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
382 /modules/iqitthemeeditor/translations/it.php
383 /override/classes/Category.php
384 /classes/Category.php
385 /classes/webservice/WebserviceRequest.php
386 /src/Adapter/ContainerBuilder.php
387 /src/Adapter/Environment.php
388 /src/Core/EnvironmentInterface.php
389 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
390 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
391 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
392 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
393 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
394 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
395 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
396 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
397 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
398 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
399 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
400 /vendor/symfony/contracts/Service/ResetInterface.php
401 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
402 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
403 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
404 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
405 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
406 /vendor/symfony/contracts/Cache/ItemInterface.php
407 /vendor/psr/cache/src/CacheItemInterface.php
408 /vendor/psr/cache/src/CacheItemPoolInterface.php
409 /vendor/symfony/contracts/Cache/CacheInterface.php
410 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
411 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
412 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
413 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
414 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
415 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
416 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
417 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
418 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
419 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
420 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
421 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
422 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
423 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
424 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
425 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
426 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
427 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
428 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
429 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
430 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
431 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
432 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
433 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
434 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
435 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
436 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
437 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
438 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
439 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
440 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
441 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
442 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
443 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
444 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
445 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
446 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
447 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
448 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
449 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
450 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
451 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
452 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
453 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
454 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
455 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
456 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
457 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
458 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
459 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
460 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
461 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
462 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
463 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
464 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
465 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
466 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
467 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
468 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
469 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
470 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
471 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
472 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
473 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
474 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
475 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
476 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
477 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
478 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
479 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
480 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ReflectionClassResource.php
481 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/DirectoryResource.php
482 /var/cache/dev/FrontContainer.php
483 /src/Adapter/Container/LegacyContainer.php
484 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
485 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
486 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
487 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
488 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
489 /vendor/psr/container/src/ContainerExceptionInterface.php
490 /vendor/psr/container/src/NotFoundExceptionInterface.php
491 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
492 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
493 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
494 /src/Adapter/Container/LegacyContainerInterface.php
495 /modules/ps_shoppingcart/vendor/autoload.php
496 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
497 /modules/ps_shoppingcart/vendor/composer/platform_check.php
498 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
499 /modules/ps_emailsubscription/vendor/autoload.php
500 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
501 /modules/ps_emailsubscription/vendor/composer/platform_check.php
502 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
503 /modules/productcomments/vendor/autoload.php
504 /modules/productcomments/vendor/composer/autoload_real.php
505 /modules/productcomments/vendor/composer/platform_check.php
506 /modules/productcomments/vendor/composer/autoload_static.php
507 /modules/ps_facetedsearch/vendor/autoload.php
508 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
509 /modules/ps_facetedsearch/vendor/composer/platform_check.php
510 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
511 /modules/contactform/vendor/autoload.php
512 /modules/contactform/vendor/composer/autoload_real.php
513 /modules/contactform/vendor/composer/platform_check.php
514 /modules/contactform/vendor/composer/autoload_static.php
515 /modules/ps_emailalerts/vendor/autoload.php
516 /modules/ps_emailalerts/vendor/composer/autoload_real.php
517 /modules/ps_emailalerts/vendor/composer/platform_check.php
518 /modules/ps_emailalerts/vendor/composer/autoload_static.php
519 /modules/ps_checkpayment/vendor/autoload.php
520 /modules/ps_checkpayment/vendor/composer/autoload_real.php
521 /modules/ps_checkpayment/vendor/composer/platform_check.php
522 /modules/ps_checkpayment/vendor/composer/autoload_static.php
523 /modules/ps_wirepayment/vendor/autoload.php
524 /modules/ps_wirepayment/vendor/composer/autoload_real.php
525 /modules/ps_wirepayment/vendor/composer/platform_check.php
526 /modules/ps_wirepayment/vendor/composer/autoload_static.php
527 /modules/statscheckup/vendor/autoload.php
528 /modules/statscheckup/vendor/composer/autoload_real.php
529 /modules/statscheckup/vendor/composer/platform_check.php
530 /modules/statscheckup/vendor/composer/autoload_static.php
531 /modules/statscatalog/vendor/autoload.php
532 /modules/statscatalog/vendor/composer/autoload_real.php
533 /modules/statscatalog/vendor/composer/platform_check.php
534 /modules/statscatalog/vendor/composer/autoload_static.php
535 /modules/dashactivity/vendor/autoload.php
536 /modules/dashactivity/vendor/composer/autoload_real.php
537 /modules/dashactivity/vendor/composer/platform_check.php
538 /modules/dashactivity/vendor/composer/autoload_static.php
539 /modules/dashproducts/vendor/autoload.php
540 /modules/dashproducts/vendor/composer/autoload_real.php
541 /modules/dashproducts/vendor/composer/platform_check.php
542 /modules/dashproducts/vendor/composer/autoload_static.php
543 /modules/dashtrends/vendor/autoload.php
544 /modules/dashtrends/vendor/composer/autoload_real.php
545 /modules/dashtrends/vendor/composer/platform_check.php
546 /modules/dashtrends/vendor/composer/autoload_static.php
547 /modules/ps_distributionapiclient/vendor/autoload.php
548 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
549 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
550 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
551 /modules/pagesnotfound/vendor/autoload.php
552 /modules/pagesnotfound/vendor/composer/autoload_real.php
553 /modules/pagesnotfound/vendor/composer/platform_check.php
554 /modules/pagesnotfound/vendor/composer/autoload_static.php
555 /modules/statsproduct/vendor/autoload.php
556 /modules/statsproduct/vendor/composer/autoload_real.php
557 /modules/statsproduct/vendor/composer/platform_check.php
558 /modules/statsproduct/vendor/composer/autoload_static.php
559 /modules/ps_themecusto/vendor/autoload.php
560 /modules/ps_themecusto/vendor/composer/autoload_real.php
561 /modules/ps_themecusto/vendor/composer/platform_check.php
562 /modules/ps_themecusto/vendor/composer/autoload_static.php
563 /modules/ps_checkout/vendor/autoload.php
564 /modules/ps_checkout/vendor/composer/autoload_real.php
565 /modules/ps_checkout/vendor/composer/platform_check.php
566 /modules/ps_checkout/vendor/composer/autoload_static.php
567 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
568 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment.php
569 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Client.php
570 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
571 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
572 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
573 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
574 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
575 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
576 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Version.php
577 /modules/ps_accounts/vendor/autoload.php
578 /modules/ps_accounts/vendor/composer/autoload_real.php
579 /modules/ps_accounts/vendor/composer/platform_check.php
580 /modules/ps_accounts/vendor/composer/autoload_static.php
581 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
582 /modules/ps_accounts/vendor/symfony/polyfill-php70/bootstrap.php
583 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions_include.php
584 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions.php
585 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions_include.php
586 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions.php
587 /modules/ps_accounts/vendor/symfony/polyfill-apcu/bootstrap.php
588 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions_include.php
589 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions.php
590 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
591 /modules/gmerchantcenterpro/vendor/autoload.php
592 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
593 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
594 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
595 /modules/ganalyticspro/vendor/autoload.php
596 /modules/ganalyticspro/vendor/composer/autoload_real.php
597 /modules/ganalyticspro/vendor/composer/platform_check.php
598 /modules/ganalyticspro/vendor/composer/autoload_static.php
599 /modules/fattura24/vendor/autoload.php
600 /modules/fattura24/vendor/composer/autoload_real.php
601 /modules/fattura24/vendor/composer/autoload_static.php
602 /modules/payplug/vendor/autoload.php
603 /modules/payplug/vendor/composer/autoload_real.php
604 /modules/payplug/vendor/composer/autoload_static.php
605 /modules/sendinblue/vendor/autoload.php
606 /modules/sendinblue/vendor/composer/autoload_real.php
607 /modules/sendinblue/vendor/composer/platform_check.php
608 /modules/sendinblue/vendor/composer/autoload_static.php
609 /modules/gremarketing/vendor/autoload.php
610 /modules/gremarketing/vendor/composer/autoload_real.php
611 /modules/gremarketing/vendor/composer/platform_check.php
612 /modules/gremarketing/vendor/composer/autoload_static.php
613 /modules/feedaty/vendor/autoload.php
614 /modules/feedaty/vendor/composer/autoload_real.php
615 /modules/feedaty/vendor/composer/autoload_static.php
616 /modules/seoimg/vendor/autoload.php
617 /modules/seoimg/vendor/composer/autoload_real.php
618 /modules/seoimg/vendor/composer/platform_check.php
619 /modules/seoimg/vendor/composer/autoload_static.php
620 /modules/psrecaptcha/vendor/autoload.php
621 /modules/psrecaptcha/vendor/composer/autoload_real.php
622 /modules/psrecaptcha/vendor/composer/platform_check.php
623 /modules/psrecaptcha/vendor/composer/autoload_static.php
624 /modules/autoupgrade/vendor/autoload.php
625 /modules/autoupgrade/vendor/composer/autoload_real.php
626 /modules/autoupgrade/vendor/composer/autoload_static.php
627 /modules/lgcookieslaw/vendor/autoload.php
628 /modules/lgcookieslaw/vendor/composer/autoload_real.php
629 /modules/lgcookieslaw/vendor/composer/autoload_static.php
630 /src/Core/Localization/Locale/Repository.php
631 /src/Core/Localization/Locale/RepositoryInterface.php
632 /src/Core/Localization/CLDR/LocaleRepository.php
633 /src/Core/Localization/CLDR/LocaleDataSource.php
634 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
635 /src/Core/Data/Layer/AbstractDataLayer.php
636 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
637 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
638 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
639 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
640 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
641 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
642 /vendor/symfony/contracts/Cache/CacheTrait.php
643 /vendor/psr/cache/src/InvalidArgumentException.php
644 /vendor/psr/cache/src/CacheException.php
645 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
646 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
647 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
648 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
649 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
650 /src/Core/Localization/CLDR/Reader.php
651 /src/Core/Localization/CLDR/ReaderInterface.php
652 /src/Core/Localization/Currency/Repository.php
653 /src/Core/Localization/Currency/RepositoryInterface.php
654 /src/Core/Localization/Currency/CurrencyDataSource.php
655 /src/Core/Localization/Currency/DataSourceInterface.php
656 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
657 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
658 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
659 /src/Adapter/Currency/CurrencyDataProvider.php
660 /src/Core/Currency/CurrencyDataProviderInterface.php
661 /src/Adapter/LegacyContext.php
662 /src/Adapter/Tools.php
663 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
664 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
665 /vendor/prestashop/decimal/src/Operation/Rounding.php
666 /src/Core/Localization/Locale.php
667 /src/Core/Localization/LocaleInterface.php
668 /src/Core/Localization/Specification/Price.php
669 /src/Core/Localization/Specification/Number.php
670 /src/Core/Localization/Specification/NumberInterface.php
671 /src/Core/Localization/Specification/Factory.php
672 /src/Core/Localization/CLDR/LocaleData.php
673 /src/Core/Localization/CLDR/NumberSymbolsData.php
674 /src/Core/Localization/CLDR/CurrencyData.php
675 /src/Core/Localization/CLDR/Locale.php
676 /src/Core/Localization/CLDR/LocaleInterface.php
677 /src/Core/Localization/Specification/NumberSymbolList.php
678 /classes/Currency.php
679 /src/Core/Localization/Currency/LocalizedCurrencyId.php
680 /src/Core/Localization/Currency/CurrencyData.php
681 /src/Core/Localization/Currency/CurrencyCollection.php
682 /src/Core/Localization/Currency.php
683 /src/Core/Localization/CurrencyInterface.php
684 /src/Core/Localization/Specification/NumberCollection.php
685 /src/Core/Localization/Number/Formatter.php
686 /classes/Cart.php
687 /src/Adapter/AddressFactory.php
688 /classes/CartRule.php
689 /override/classes/Product.php
690 /classes/Product.php
691 /src/Core/Domain/Product/ValueObject/RedirectType.php
692 /src/Core/Util/DateTime/DateTime.php
693 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
694 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
695 /src/Core/Domain/Product/ValueObject/ProductType.php
696 /src/Core/Domain/Product/ValueObject/Reference.php
697 /src/Core/Domain/Product/ValueObject/Ean13.php
698 /src/Core/Domain/Product/ValueObject/Isbn.php
699 /src/Core/Domain/Product/ValueObject/Upc.php
700 /src/Core/Domain/Product/ProductSettings.php
701 /src/Core/Domain/Shop/ValueObject/ShopId.php
702 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
703 /modules/ps_emailsubscription/ps_emailsubscription.php
704 /src/Core/Module/WidgetInterface.php
705 /classes/Media.php
706 /modules/ps_emailalerts/ps_emailalerts.php
707 /modules/ps_emailalerts/MailAlert.php
708 /modules/ps_checkout/ps_checkout.php
709 /classes/PaymentModule.php
710 /modules/ps_checkout/translations/it.php
711 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
712 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
713 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
714 /var/cache/dev/Ps_checkout8400FrontContainer.php
715 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
716 /modules/ps_checkout/src/Validator/MerchantValidator.php
717 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
718 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
719 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
720 /modules/ps_checkout/src/Shop/ShopProvider.php
721 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
722 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
723 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
724 /modules/ps_checkout/src/Repository/PsAccountRepository.php
725 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
726 /modules/ps_mbo/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
727 /src/Core/Addon/Module/ModuleManagerBuilder.php
728 /var/cache/dev/yaml/1deb99a1745c58282b5926d8d607faaa.php
729 /src/Adapter/LegacyLogger.php
730 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
731 /src/Adapter/Module/ModuleDataProvider.php
732 /src/Adapter/Module/AdminModuleDataProvider.php
733 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
734 /src/Adapter/Module/Module.php
735 /src/Core/Module/ModuleInterface.php
736 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
737 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
738 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
739 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
740 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
741 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
742 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
743 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
744 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
745 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
746 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
747 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
748 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
749 /src/Adapter/Module/ModuleDataUpdater.php
750 /src/Core/Module/ModuleManager.php
751 /src/Core/Module/ModuleManagerInterface.php
752 /src/Core/Module/ModuleRepository.php
753 /src/Core/Module/ModuleRepositoryInterface.php
754 /src/Adapter/HookManager.php
755 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
756 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
757 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
758 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
759 /modules/ps_distributionapiclient/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
760 /src/Core/Hook/HookDispatcherInterface.php
761 /modules/ps_accounts/ps_accounts.php
762 /modules/ps_accounts/src/Hook/HookableTrait.php
763 /modules/ps_accounts/src/Module/Install.php
764 /modules/ps_accounts/translations/it.php
765 /modules/ps_accounts/src/DependencyInjection/ServiceContainer.php
766 /modules/ps_accounts/src/DependencyInjection/ContainerProvider.php
767 /var/cache/dev/Ps_accounts701FrontContainer.php
768 /modules/ps_accounts/src/Service/PsAccountsService.php
769 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
770 /modules/ps_accounts/src/Account/Session/Session.php
771 /modules/ps_accounts/src/Account/Session/SessionInterface.php
772 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
773 /modules/ps_accounts/src/Adapter/Configuration.php
774 /modules/ps_accounts/src/Account/Session/ShopSession.php
775 /modules/ps_accounts/src/Account/Session/RefreshFirebaseTokens.php
776 /modules/ps_accounts/src/Provider/OAuth2/ShopProvider.php
777 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/PrestaShop.php
778 /modules/ps_accounts/vendor/league/oauth2-client/src/Provider/AbstractProvider.php
779 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/ArrayAccessorTrait.php
780 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/GuardedPropertyTrait.php
781 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/QueryBuilderTrait.php
782 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/BearerAuthorizationTrait.php
783 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/LogoutTrait.php
784 /modules/ps_accounts/src/Provider/OAuth2/Oauth2Client.php
785 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
786 /modules/ps_accounts/src/Type/Enum.php
787 /modules/ps_accounts/src/Adapter/Link.php
788 /modules/ps_accounts/src/Context/ShopContext.php
789 /modules/ps_accounts/vendor/league/oauth2-client/src/Grant/GrantFactory.php
790 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/RequestFactory.php
791 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Client.php
792 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/ClientInterface.php
793 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/HandlerStack.php
794 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/Proxy.php
795 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlMultiHandler.php
796 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactory.php
797 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactoryInterface.php
798 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlHandler.php
799 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/StreamHandler.php
800 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Middleware.php
801 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/RedirectMiddleware.php
802 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/PostAuthOptionProvider.php
803 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/OptionProviderInterface.php
804 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
805 /modules/ps_accounts/src/Account/LinkShop.php
806 /modules/ps_checkout/src/Context/PrestaShopContext.php
807 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
808 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
809 /modules/ps_checkout/src/Version/Version.php
810 /modules/psrecaptcha/psrecaptcha.php
811 /modules/psrecaptcha/translations/it.php
812 /classes/ProductDownload.php
813 /classes/tax/Tax.php
814 /src/Core/Localization/CLDR/ComputingPrecision.php
815 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
816 /src/Core/Cart/Calculator.php
817 /src/Core/Cart/CartRowCollection.php
818 /src/Core/Cart/Fees.php
819 /src/Core/Cart/AmountImmutable.php
820 /src/Core/Cart/CartRuleCollection.php
821 /src/Core/Cart/CartRuleCalculator.php
822 /src/Adapter/Product/PriceCalculator.php
823 /classes/order/Order.php
824 /src/Core/Cart/CartRow.php
825 /vendor/prestashop/decimal/src/DecimalNumber.php
826 /vendor/prestashop/decimal/src/Builder.php
827 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
828 /classes/Gender.php
829 /classes/Risk.php
830 /classes/Meta.php
831 /modules/revsliderprestashop/revsliderprestashop.php
832 /modules/revsliderprestashop/rev-loader.php
833 /modules/revsliderprestashop/includes/revslider_db.class.php
834 /modules/revsliderprestashop/includes/data.class.php
835 /modules/revsliderprestashop/includes/functions.class.php
836 /modules/revsliderprestashop/includes/em-integration.class.php
837 /modules/revsliderprestashop/includes/cssparser.class.php
838 /modules/revsliderprestashop/includes/woocommerce.class.php
839 /modules/revsliderprestashop/includes/wpml.class.php
840 /modules/revsliderprestashop/includes/colorpicker.class.php
841 /modules/revsliderprestashop/includes/navigation.class.php
842 /modules/revsliderprestashop/includes/object-library.class.php
843 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
844 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
845 /modules/revsliderprestashop/includes/extension.class.php
846 /modules/revsliderprestashop/includes/favorite.class.php
847 /modules/revsliderprestashop/includes/aq-resizer.class.php
848 /modules/revsliderprestashop/includes/external-sources.class.php
849 /modules/revsliderprestashop/includes/page-template.class.php
850 /modules/revsliderprestashop/includes/slider.class.php
851 /modules/revsliderprestashop/includes/slide.class.php
852 /modules/revsliderprestashop/includes/output.class.php
853 /modules/revsliderprestashop/public/revslider-front.class.php
854 /modules/revsliderprestashop/includes/backwards.php
855 /modules/revsliderprestashop/admin/includes/class-pclzip.php
856 /modules/revsliderprestashop/admin/includes/license.class.php
857 /modules/revsliderprestashop/admin/includes/addons.class.php
858 /modules/revsliderprestashop/admin/includes/template.class.php
859 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
860 /modules/revsliderprestashop/admin/includes/folder.class.php
861 /modules/revsliderprestashop/admin/includes/import.class.php
862 /modules/revsliderprestashop/admin/includes/export.class.php
863 /modules/revsliderprestashop/admin/includes/export-html.class.php
864 /modules/revsliderprestashop/admin/includes/newsletter.class.php
865 /modules/revsliderprestashop/admin/revslider-admin.class.php
866 /modules/revsliderprestashop/includes/update.class.php
867 /modules/revsliderprestashop/includes/resize-imag.php
868 /modules/revsliderprestashop/translations/it.php
869 /override/classes/Address.php
870 /classes/Address.php
871 /modules/arteinvoice/arteinvoice.php
872 /modules/arteinvoice/translations/it.php
873 /classes/ImageType.php
874 /classes/State.php
875 /src/Core/Security/PasswordPolicyConfiguration.php
876 /src/Core/Configuration/DataConfigurationInterface.php
877 /src/Core/Security/Hashing.php
878 /src/Core/Filter/FrontEndObject/MainFilter.php
879 /src/Core/Filter/FilterInterface.php
880 /src/Core/Filter/FrontEndObject/CartFilter.php
881 /src/Core/Filter/HashMapWhitelistFilter.php
882 /src/Core/Filter/CollectionFilter.php
883 /src/Core/Filter/FrontEndObject/ProductFilter.php
884 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
885 /src/Core/Filter/FrontEndObject/CustomerFilter.php
886 /src/Core/Filter/FrontEndObject/ShopFilter.php
887 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
888 /modules/lgcookieslaw/lgcookieslaw.php
889 /modules/lgcookieslaw/config/config.inc.php
890 /modules/lgcookieslaw/translations/it.php
891 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php
892 /vendor/defuse/php-encryption/src/Crypto.php
893 /vendor/defuse/php-encryption/src/KeyOrPassword.php
894 /vendor/defuse/php-encryption/src/RuntimeTests.php
895 /vendor/defuse/php-encryption/src/DerivedKeys.php
896 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
897 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
898 /classes/Smarty/SmartyDevTemplate.php
899 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
900 /var/cache/dev/smarty/compile/37/43/2c/37432c861bff16f5b2f4e73e17290a859706693a_2.file.view_cookies_scripts_content.tpl.php
901 /var/cache/dev/smarty/compile/19/c5/80/19c58092aad1b9d2c0faefe208b7555546f1a69f_2.file.view_header.tpl.php
902 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
903 /modules/ps_shoppingcart/ps_shoppingcart.php
904 /modules/productcomments/productcomments.php
905 /modules/iqitcompare/iqitcompare.php
906 /modules/iqitcompare/translations/it.php
907 /modules/iqitcontactpage/iqitcontactpage.php
908 /modules/iqitcontactpage/translations/it.php
909 /modules/iqitcountdown/iqitcountdown.php
910 /modules/iqitcountdown/translations/it.php
911 /modules/iqitelementor/iqitelementor.php
912 /modules/iqitelementor/src/IqitElementorLanding.php
913 /modules/iqitelementor/src/IqitElementorTemplate.php
914 /modules/iqitelementor/src/IqitElementorProduct.php
915 /modules/iqitelementor/src/IqitElementorCategory.php
916 /modules/iqitelementor/src/IqitElementorContent.php
917 /modules/iqitelementor/src/iqitElementorWpHelper.php
918 /modules/iqitelementor/includes/plugin-elementor.php
919 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
920 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
921 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
922 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
923 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
924 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
925 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
926 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
927 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
928 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
929 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
930 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
931 /modules/iqitelementor/translations/it.php
932 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
933 /modules/iqitfreedeliverycount/translations/it.php
934 /modules/iqitmegamenu/iqitmegamenu.php
935 /modules/iqitmegamenu/models/IqitMenuTab.php
936 /modules/iqitmegamenu/models/IqitMenuHtml.php
937 /modules/iqitmegamenu/models/IqitMenuLinks.php
938 /modules/iqitmegamenu/translations/it.php
939 /modules/iqitreviews/iqitreviews.php
940 /modules/iqitreviews/src/IqitProductReview.php
941 /modules/iqitwishlist/iqitwishlist.php
942 /modules/iqitwishlist/src/IqitWishlistProduct.php
943 /modules/iqitwishlist/translations/it.php
944 /modules/iqitextendedproduct/iqitextendedproduct.php
945 /modules/iqitextendedproduct/src/IqitThreeSixty.php
946 /modules/iqitextendedproduct/src/IqitProductVideo.php
947 /modules/iqitextendedproduct/translations/it.php
948 /modules/artproduttori/artproduttori.php
949 /modules/artproduttori/translations/it.php
950 /var/cache/dev/smarty/compile/shopwarehouse/2a/78/bf/2a78bfe324326a3e5b719fcedc43fa2217413e51_2.file.scriptV9.tpl.php
951 /modules/ganalyticspro/ganalyticspro.php
952 /modules/ganalyticspro/translations/it.php
953 /modules/ganalyticspro/lib/moduleTools.php
954 /modules/ganalyticspro/conf/moduleConfiguration.php
955 /modules/ganalyticspro/lib/hook/hookController.php
956 /modules/ganalyticspro/lib/hook/hookDisplay.php
957 /modules/ganalyticspro/lib/hook/hookInterface.php
958 /modules/ganalyticspro/lib/gtag/baseTag.php
959 /modules/ganalyticspro/lib/gtag/categoryTag.php
960 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
961 /classes/Combination.php
962 /classes/stock/StockAvailable.php
963 /classes/SpecificPrice.php
964 /classes/tax/TaxManagerFactory.php
965 /classes/tax/TaxRulesTaxManager.php
966 /classes/tax/TaxManagerInterface.php
967 /classes/tax/TaxCalculator.php
968 /classes/GroupReduction.php
969 /classes/Pack.php
970 /override/classes/Manufacturer.php
971 /classes/Manufacturer.php
972 /classes/Tag.php
973 /modules/ganalyticspro/models/orderRefund.php
974 /modules/ganalyticspro/models/orderPartialRefund.php
975 /var/cache/dev/smarty/compile/shopwarehouse/1c/84/58/1c8458cc9d4e9ed9c19ec87cbfcb12174e2707f9_2.file.header.tpl.php
976 /var/cache/dev/smarty/compile/shopwarehouse/b4/00/ef/b400eff9187b1d53d67faeda1e6035db24007b26_2.file.apichatgpt.tpl.php
977 /var/cache/dev/smarty/compile/shopwarehouse/67/1c/ce/671ccec8ce19597b0b74aa75c89c3e503b4f00be_2.file.head.tpl.php
978 /modules/shinystat/shinystat.php
979 /modules/shinystat/translations/it.php
980 /modules/ets_integrategooglemarketing/ets_integrategooglemarketing.php
981 /modules/ets_integrategooglemarketing/classes/Ets_integrategooglemarketing_defines.php
982 /modules/ets_integrategooglemarketing/translations/it.php
983 /var/cache/dev/smarty/compile/shopwarehouse/a5/b7/a4/a5b7a45ca285fcbfe2b88dceb9824ebefab6b6ac_2.file.google_tag_head.tpl.php
984 /var/cache/dev/smarty/compile/shopwarehouse/ce/33/81/ce33814f2d98ddedf15ce7084df0cb6273514cb7_2.file.google_search_console.tpl.php
985 /modules/cdc_googletagmanager/cdc_googletagmanager.php
986 /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php
987 /modules/cdc_googletagmanager/services/CdcTools.php
988 /modules/cdc_googletagmanager/services/PrestashopUtils.php
989 /modules/cdc_googletagmanager/classes/DataLayer.php
990 /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php
991 /modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php
992 /modules/cdc_googletagmanager/services/Gtm_Product.php
993 /modules/cdc_googletagmanager/classes/gtm/Refund.php
994 /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php
995 /modules/cdc_googletagmanager/classes/gtm_ga4/DataLayerItem.php
996 /modules/cdc_googletagmanager/translations/it.php
997 /modules/gremarketing/gremarketing.php
998 /modules/gremarketing/lib/moduleTools.php
999 /modules/gremarketing/translations/it.php
1000 /modules/gremarketing/conf/moduleConfiguration.php
1001 /modules/gremarketing/lib/hook/hookController.php
1002 /modules/gremarketing/lib/hook/hookDisplay.php
1003 /modules/gremarketing/lib/hook/hookBase.php
1004 /modules/gmerchantcenterpro/gmerchantcenterpro.php
1005 /modules/gmerchantcenterpro/translations/it.php
1006 /modules/gmerchantcenterpro/lib/moduleTools.php
1007 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
1008 /modules/gmerchantcenterpro/lib/moduleUpdate.php
1009 /modules/gmerchantcenterpro/lib/install/installController.php
1010 /modules/gmerchantcenterpro/lib/install/installSql.php
1011 /modules/gmerchantcenterpro/lib/install/installInterface.php
1012 /modules/gmerchantcenterpro/models/Feeds.php
1013 /modules/gremarketing/lib/tags/baseDynTag.php
1014 /modules/gremarketing/lib/tags/dynamicCategoryTag.php
1015 /var/cache/dev/smarty/compile/shopwarehouse/2f/9e/ea/2f9eea5170ce390e3df3ef367d69faf4aa1dac49_2.file.header.tpl.php
1016 /modules/connettore/connettore.php
1017 /modules/connettore/configurazione/configurazione_connettore.php
1018 /modules/connettore/classes/AnubiLogger.php
1019 /modules/connettore/classes/AnubiDbPDO.php
1020 /modules/connettore/classes/DbWrapper.php
1021 /modules/connettore/classes/BaseTask.php
1022 /modules/connettore/classes/DbConnettore.php
1023 /modules/connettore/classes/WebHelper.php
1024 /modules/connettore/classes/Utils.php
1025 /modules/connettore/classes/TestataOrdine.php
1026 /modules/connettore/classes/RigaOrdine.php
1027 /modules/connettore/tasks/TestTask.php
1028 /modules/connettore/tasks/ImportazioneDatiTask.php
1029 /modules/connettore/tasks/ImportazioneNuoveCategorieTask.php
1030 /modules/connettore/tasks/AggiornamentoCategorieTask.php
1031 /modules/connettore/tasks/ImportazioneNuoveFunzioniTask.php
1032 /modules/connettore/tasks/ImportazioneNuoviProdottiTask.php
1033 /modules/connettore/tasks/AggiornamentoProdottiTask.php
1034 /modules/connettore/tasks/ImportazioneImmaginiProdottoTask.php
1035 /modules/connettore/tasks/AttivazioneProdottiTask.php
1036 /modules/connettore/tasks/AggiornamentoDisponibilitaTask.php
1037 /modules/connettore/tasks/ImportazioneNuoviManufacturerTask.php
1038 /modules/connettore/tasks/EliminaProdottiCheNonEsistonoTask.php
1039 /modules/connettore/tasks/ImportazioneCorrelatiTask.php
1040 /modules/connettore/tasks/AggiornamentoTagTask.php
1041 /modules/connettore/tasks/AggiornamentoGiacenzeTask.php
1042 /modules/connettore/tasks/IndicizzazioneProdottiTask.php
1043 /modules/connettore/translations/it.php
1044 /modules/feedaty/feedaty.php
1045 /modules/feedaty/translations/it.php
1046 /modules/feedaty/it.php
1047 /modules/feedaty/lib/FeedatyClasses.php
1048 /modules/feedaty/lib/FeedatyWebservice.php
1049 /modules/feedaty/lib/FeedatyPositions.php
1050 /modules/feedaty/lib/FeedatyProtocols.php
1051 /modules/feedaty/lib/FeedatyGenerateElements.php
1052 /modules/feedaty/lib/FeedatyCsvController.php
1053 /modules/tec_dataminimizer/tec_dataminimizer.php
1054 /modules/ec_minorder/ec_minorder.php
1055 /modules/ec_minorder/translations/it.php
1056 /modules/multipleprices/multipleprices.php
1057 /modules/multipleprices/classes/MultiplepricesConfiguration.php
1058 /modules/multipleprices/translations/it.php
1059 /var/cache/dev/smarty/compile/shopwarehouse/1e/5b/1e/1e5b1ed75e7d2edf5948921999bdb0cfc282f073_2.file.styles.tpl.php
1060 /modules/payplug/payplug.php
1061 /modules/payplug/translations/it.php
1062 /modules/payplug/classes/PayPlugDependencies.php
1063 /modules/payplug/classes/DependenciesClass.php
1064 /modules/payplug/src/utilities/validators/accountValidator.php
1065 /modules/payplug/src/utilities/validators/browserValidator.php
1066 /modules/payplug/src/utilities/validators/cardValidator.php
1067 /modules/payplug/src/utilities/validators/lockValidator.php
1068 /modules/payplug/src/utilities/validators/loggerValidator.php
1069 /modules/payplug/src/utilities/validators/moduleValidator.php
1070 /modules/payplug/src/utilities/validators/orderValidator.php
1071 /modules/payplug/src/utilities/validators/paymentValidator.php
1072 /modules/payplug/src/utilities/helpers/AmountHelper.php
1073 /modules/payplug/src/utilities/helpers/ConfigurationHelper.php
1074 /modules/payplug/src/utilities/helpers/CookiesHelper.php
1075 /modules/payplug/src/utilities/helpers/FilesHelper.php
1076 /modules/payplug/src/utilities/helpers/PhoneHelper.php
1077 /modules/payplug/src/utilities/helpers/UserHelper.php
1078 /modules/payplug/src/application/dependencies/PluginInit.php
1079 /modules/payplug/src/application/dependencies/BaseClass.php
1080 /modules/payplug/src/actions/CardAction.php
1081 /modules/payplug/src/actions/CartAction.php
1082 /modules/payplug/src/actions/ConfigurationAction.php
1083 /modules/payplug/src/actions/MerchantTelemetryAction.php
1084 /modules/payplug/src/actions/OnboardingAction.php
1085 /modules/payplug/src/actions/OneyAction.php
1086 /modules/payplug/src/actions/OrderAction.php
1087 /modules/payplug/src/actions/RefundAction.php
1088 /modules/payplug/src/actions/OrderStateAction.php
1089 /modules/payplug/src/actions/PaymentAction.php
1090 /modules/payplug/src/models/entities/CacheEntity.php
1091 /modules/payplug/src/models/entities/OneyEntity.php
1092 /modules/payplug/src/models/entities/PluginEntity.php
1093 /modules/payplug/src/models/entities/OrderStateEntity.php
1094 /modules/payplug/src/application/adapter/AddressAdapter.php
1095 /modules/payplug/src/interfaces/AddressInterface.php
1096 /modules/payplug/src/application/adapter/AssignAdapter.php
1097 /modules/payplug/src/interfaces/AssignInterface.php
1098 /modules/payplug/src/application/adapter/CarrierAdapter.php
1099 /modules/payplug/src/interfaces/CarrierInterface.php
1100 /classes/Carrier.php
1101 /modules/payplug/src/application/adapter/CartAdapter.php
1102 /modules/payplug/src/interfaces/CartInterface.php
1103 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
1104 /modules/payplug/src/interfaces/ConfigurationInterface.php
1105 /modules/payplug/src/application/adapter/ConstantAdapter.php
1106 /modules/payplug/src/interfaces/ConstantInterface.php
1107 /modules/payplug/src/application/adapter/ContextAdapter.php
1108 /modules/payplug/src/interfaces/ContextInterface.php
1109 /modules/payplug/src/application/adapter/CountryAdapter.php
1110 /modules/payplug/src/interfaces/CountryInterface.php
1111 /modules/payplug/src/application/adapter/CurrencyAdapter.php
1112 /modules/payplug/src/interfaces/CurrencyInterface.php
1113 /modules/payplug/src/application/adapter/CustomerAdapter.php
1114 /modules/payplug/src/interfaces/CustomerInterface.php
1115 /modules/payplug/src/application/adapter/DispatcherAdapter.php
1116 /modules/payplug/src/interfaces/DispatcherInterface.php
1117 /modules/payplug/src/application/adapter/LanguageAdapter.php
1118 /modules/payplug/src/interfaces/LanguageInterface.php
1119 /modules/payplug/src/application/adapter/MediaAdapter.php
1120 /modules/payplug/src/interfaces/MediaInterface.php
1121 /modules/payplug/src/application/adapter/MessageAdapter.php
1122 /modules/payplug/src/interfaces/MessageInterface.php
1123 /modules/payplug/src/application/adapter/ModuleAdapter.php
1124 /modules/payplug/src/interfaces/ModuleInterface.php
1125 /modules/payplug/src/application/adapter/OrderAdapter.php
1126 /modules/payplug/src/interfaces/OrderInterface.php
1127 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
1128 /modules/payplug/src/interfaces/OrderHistoryInterface.php
1129 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
1130 /modules/payplug/src/interfaces/OrderSlipInterface.php
1131 /modules/payplug/src/application/adapter/OrderStateAdapter.php
1132 /modules/payplug/src/interfaces/OrderStateInterface.php
1133 /classes/order/OrderState.php
1134 /modules/payplug/src/application/adapter/ProductAdapter.php
1135 /modules/payplug/src/interfaces/ProductInterface.php
1136 /modules/payplug/src/application/adapter/QueryAdapter.php
1137 /modules/payplug/src/interfaces/QueryInterface.php
1138 /modules/payplug/src/application/adapter/ShopAdapter.php
1139 /modules/payplug/src/interfaces/ShopInterface.php
1140 /modules/payplug/src/application/adapter/TabAdapter.php
1141 /modules/payplug/src/interfaces/TabInterface.php
1142 /modules/payplug/src/application/adapter/ToolsAdapter.php
1143 /modules/payplug/src/interfaces/ToolsInterface.php
1144 /modules/payplug/src/application/adapter/TranslationAdapter.php
1145 /modules/payplug/src/interfaces/TranslationInterface.php
1146 /modules/payplug/src/application/adapter/ValidateAdapter.php
1147 /modules/payplug/src/interfaces/ValidateInterface.php
1148 /modules/payplug/src/models/classes/Address.php
1149 /modules/payplug/src/models/classes/ApiRest.php
1150 /modules/payplug/src/models/classes/Configuration.php
1151 /modules/payplug/src/models/classes/Country.php
1152 /modules/payplug/src/models/classes/Order.php
1153 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
1154 /modules/payplug/src/models/classes/Translation.php
1155 /modules/payplug/src/models/repositories/CardRepository.php
1156 /modules/payplug/src/models/repositories/QueryRepository.php
1157 /modules/payplug/src/models/repositories/CacheRepository.php
1158 /modules/payplug/src/models/repositories/CountryRepository.php
1159 /modules/payplug/src/models/repositories/LockRepository.php
1160 /modules/payplug/src/models/repositories/LoggerRepository.php
1161 /modules/payplug/src/models/repositories/ModuleRepository.php
1162 /modules/payplug/src/models/repositories/OrderRepository.php
1163 /modules/payplug/src/models/repositories/OrderStateRepository.php
1164 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
1165 /modules/payplug/src/models/repositories/PaymentRepository.php
1166 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
1167 /modules/payplug/src/models/repositories/ShopRepository.php
1168 /modules/payplug/classes/MyLogPHP.php
1169 /modules/payplug/src/repositories/LoggerRepository.php
1170 /modules/payplug/src/models/entities/LoggerEntity.php
1171 /modules/payplug/src/repositories/TranslationsRepository.php
1172 /modules/payplug/src/repositories/SQLtableRepository.php
1173 /modules/payplug/src/repositories/CacheRepository.php
1174 /modules/payplug/src/repositories/OrderStateRepository.php
1175 /modules/payplug/src/repositories/InstallRepository.php
1176 /modules/payplug/src/utilities/services/API.php
1177 /modules/payplug/src/utilities/services/Browser.php
1178 /modules/payplug/src/utilities/services/Routes.php
1179 /modules/payplug/src/utilities/services/MerchantTelemetry.php
1180 /modules/payplug/classes/ApiClass.php
1181 /modules/payplug/classes/ApplePayClass.php
1182 /modules/payplug/classes/AmountCurrencyClass.php
1183 /modules/payplug/classes/AdminClass.php
1184 /modules/payplug/classes/PayplugLock.php
1185 /modules/payplug/classes/CartClass.php
1186 /modules/payplug/classes/ConfigClass.php
1187 /modules/payplug/classes/InstallmentClass.php
1188 /modules/payplug/classes/HookClass.php
1189 /modules/payplug/classes/MediaClass.php
1190 /modules/payplug/classes/OrderClass.php
1191 /modules/payplug/classes/PaymentClass.php
1192 /modules/payplug/classes/RefundClass.php
1193 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1194 /modules/sendinblue/sendinblue.php
1195 /modules/sendinblue/translations/it.php
1196 /modules/sendinblue/services/ConfigService.php
1197 /modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php
1198 /modules/absfrequentlyboughttogether/class/AbsBuyItWith.php
1199 /modules/absfrequentlyboughttogether/class/AbsPromoFqb.php
1200 /modules/absfrequentlyboughttogether/translations/it.php
1201 /modules/trustedprogramintegration/trustedprogramintegration.php
1202 /modules/trustedprogramintegration/translations/it.php
1203 /src/Core/Product/Search/ProductSearchContext.php
1204 /src/Core/Product/Search/ProductSearchQuery.php
1205 /src/Core/Product/Search/SortOrder.php
1206 /modules/ps_facetedsearch/ps_facetedsearch.php
1207 /modules/ps_facetedsearch/src/HookDispatcher.php
1208 /modules/ps_facetedsearch/src/Hook/Attribute.php
1209 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1210 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1211 /modules/ps_facetedsearch/src/Hook/Category.php
1212 /modules/ps_facetedsearch/src/Hook/Configuration.php
1213 /modules/ps_facetedsearch/src/Hook/Design.php
1214 /modules/ps_facetedsearch/src/Hook/Feature.php
1215 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1216 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1217 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1218 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1219 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1220 /modules/ps_facetedsearch/src/Hook/Product.php
1221 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1222 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1223 /modules/ps_facetedsearch/src/Filters/Provider.php
1224 /modules/ps_facetedsearch/src/URLSerializer.php
1225 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1226 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1227 /src/Core/Product/Search/FacetsRendererInterface.php
1228 /src/Core/Product/Search/ProductSearchProviderInterface.php
1229 /modules/ps_facetedsearch/src/Filters/Converter.php
1230 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1231 /src/Core/Product/Search/ProductSearchResult.php
1232 /modules/ps_facetedsearch/src/Product/Search.php
1233 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1234 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1235 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1236 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1237 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1238 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1239 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1240 /modules/ps_facetedsearch/src/Filters/Products.php
1241 /modules/ps_facetedsearch/src/Filters/Block.php
1242 /modules/ps_facetedsearch/src/Definition/Availability.php
1243 /src/Core/Util/String/StringModifier.php
1244 /src/Core/Util/String/StringModifierInterface.php
1245 /src/Core/Product/Search/Facet.php
1246 /src/Core/Product/Search/Filter.php
1247 /src/Core/Product/Search/FacetCollection.php
1248 /classes/ProductAssembler.php
1249 /classes/ProductPresenterFactory.php
1250 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1251 /src/Adapter/Presenter/Product/ProductPresenter.php
1252 /src/Adapter/Product/ProductColorsRetriever.php
1253 /src/Core/Product/ProductPresentationSettings.php
1254 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1255 /src/Adapter/Presenter/Product/ProductLazyArray.php
1256 /src/Adapter/Presenter/AbstractLazyArray.php
1257 /classes/Image.php
1258 /src/Core/Image/ImageFormatConfiguration.php
1259 /src/Core/Image/ImageFormatConfigurationInterface.php
1260 /classes/FeatureFlag.php
1261 /src/Core/FeatureFlag/FeatureFlagSettings.php
1262 /src/Core/Util/Inflector.php
1263 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1264 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1265 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1266 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1267 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1268 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1269 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1270 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1271 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1272 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1273 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1274 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1275 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1276 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1277 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1278 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1279 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1280 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1281 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1282 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1283 /var/cache/dev/smarty/compile/shopwarehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1284 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1285 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1286 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1287 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1288 /var/cache/dev/smarty/compile/shopwarehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1289 /src/Core/Product/Search/Pagination.php
1290 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f8/11/cb/f811cb95a71b2aadd97e674a0f709876f06d4c42_2.file.category.tpl.php
1291 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1292 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/b2/a5/fe/b2a5fee663562893eda7670099e89eec5d81a1fb_2.file.product-list.tpl.php
1293 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/dd/fe/b9/ddfeb954e222c722253739f7845703c29eaea402_2.file.layout-left-column.tpl.php
1294 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5a/ce/e5/5acee588265771a51ffc84701e00bdd02c9abdf2_2.file.layout-both-columns.tpl.php
1295 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c5/08/43/c508439c1a96a30f9de64446737e6ee1927dfb3b_2.file.helpers.tpl.php
1296 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1297 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/6f/91/236f91d2776e44271e012c43db1c691696c15040_2.file.head.tpl.php
1298 /vendor/smarty/smarty/libs/sysplugins/smarty_undefined_variable.php
1299 /var/cache/dev/smarty/compile/shopwarehouse/27/e9/b0/27e9b031b55351a9f084c5addac17fcde073133e_2.file.gtm_tag.tpl.php
1300 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/fb/db/48/fbdb48daf1e14bbe07fd3699d645f11debb2eb1a_2.file.head-jsonld.tpl.php
1301 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/16/ce/59/16ce59339f787d6cb8ac4f7c0a7f20e99de1b839_2.file.product-list-jsonld.tpl.php
1302 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/0a/0b/4c/0a0b4c89241f913d59419ea9a3612aa6515190d1_2.file.pagination-seo.tpl.php
1303 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1304 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/b9/7c/beb97cb450a9f69fd43c061d99fbdfad7181c6f6_2.file.stylesheets.tpl.php
1305 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ae/4d/30/ae4d30f43146c6e1ffaee0607d30f548b596517f_2.file.javascript.tpl.php
1306 /var/cache/dev/smarty/compile/shopwarehouse/46/35/48/463548647f97f9e2cce954b7188c1f350dab323f_2.file.google_tag_body.tpl.php
1307 /var/cache/dev/smarty/compile/shopwarehouse/5d/db/c8/5ddbc86a06a0a0d6e76e4f9fba4952f2f24c5192_2.file.gtm_tag_noscript.tpl.php
1308 /var/cache/dev/smarty/compile/27/a8/a7/27a8a764939f2f3d8f7490893049eba541e593c2_2.file.view_after_body_opening_tag_header.tpl.php
1309 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/98/20/ef/9820ef0925d3fee40988d8cee22dbe868c6cb068_2.file.product-activation.tpl.php
1310 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/8c/bc/41/8cbc41da8acb85d754b2c50cfefb91ed607a9edf_2.file.header.tpl.php
1311 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e9/b9/d5/e9b9d508f2dd480341846be452ac6f6672284f34_2.file.social-links.tpl.php
1312 /modules/iqitlinksmanager/iqitlinksmanager.php
1313 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1314 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1315 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1316 /modules/iqitlinksmanager/translations/it.php
1317 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1318 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1319 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1320 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/10/displayNav1/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1321 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1322 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1323 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1324 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1325 /modules/iqithtmlandbanners/translations/it.php
1326 /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/10/displayNavCenter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1327 /modules/ps_languageselector/ps_languageselector.php
1328 /modules/ps_currencyselector/ps_currencyselector.php
1329 /var/cache/dev/smarty/compile/shopwarehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1330 /var/cache/dev/smarty/compile/shopwarehouse/a7/b4/2a/a7b42a5e4e0a5166bfca3e9be0e40e49bcdd454f_2.module.iqitcompareviewstemplateshookdisplaynav.tpl.php
1331 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/9a/e8/a0/9ae8a0bf6f8a38863b91cfc212bb6ceb2292b8a7_2.file.header-1.tpl.php
1332 /modules/iqitsearch/iqitsearch.php
1333 /modules/iqitsearch/translations/it.php
1334 /var/cache/dev/smarty/compile/shopwarehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1335 /var/cache/dev/smarty/compile/shopwarehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1336 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/5e/3f/235e3f5ee59d64225af247fb2228e65cd3fe7fb0_2.module.ps_shoppingcartps_shoppingcartdefault.tpl.php
1337 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1338 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1339 /modules/ps_customersignin/ps_customersignin.php
1340 /var/cache/dev/smarty/compile/shopwarehouse/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1341 /modules/pagesnotfound/pagesnotfound.php
1342 /var/cache/dev/smarty/compile/shopwarehouse/63/ba/59/63ba5972c9730522e9fb200398edbc11f4f58089_2.file.feedaty-widget-store.tpl.php
1343 /var/cache/dev/smarty/cache/iqitmegamenu/index/1/1/1/10/shopwarehouse/a8/34/6d/a8346d2dc5b79e1534b3385fa0faac4b475b9eb4.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1344 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/1c/e5/92/1ce5928ab8218bc3ddcd60c352dd1d71893f7908_2.file.mobile-header-3.tpl.php
1345 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1346 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1347 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1348 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/62/43/78/624378c7dfeb412830a19d0b0b37a8715548f5cf_2.file.breadcrumb.tpl.php
1349 /modules/iqitproductsnav/iqitproductsnav.php
1350 /modules/iqitproductsnav/translations/it.php
1351 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5e/e2/b8/5ee2b817b44046586c6272340d6af59d1a367ad4_2.file.notifications.tpl.php
1352 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/89/a9/18/89a918329b56f1c800efdd755b39ba9f219ec921_2.file.category-header.tpl.php
1353 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ef/6d/4c/ef6d4c7a880f80029c6b448812468d37383ff042_2.file.category-subcategories.tpl.php
1354 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/26/2c/5e/262c5ee15c17f10153d38421d802f53b3a380c71_2.file.products-top.tpl.php
1355 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1356 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c9/f1/91/c9f191209eb3f477d74071d448cc161f10778b3c_2.file.sort-orders.tpl.php
1357 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c1/47/e9/c147e97b1ab26489e3f10827386d1bcd455d4114_2.file.products.tpl.php
1358 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/b9/de/a6b9dee9c985ceb3eeded4c44440dc98077b6366_2.file.product-list.tpl.php
1359 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/82/b8/3a/82b83aed6eab9dedf4c24a9d0b1f481ebb09cd2c_2.file.product-miniature-thumb.tpl.php
1360 /var/cache/dev/smarty/compile/shopwarehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1361 /vendor/smarty/smarty/libs/plugins/function.math.php
1362 /var/cache/dev/smarty/compile/shopwarehouse/54/50/60/54506057f821234b35c479582bc2dc0b2fc98e35_2.file.artlistproduttori-ps17.tpl.php
1363 /vendor/smarty/smarty/libs/plugins/modifier.date_format.php
1364 /classes/ProductSupplier.php
1365 /vendor/prestashop/decimal/src/Operation/Addition.php
1366 /var/cache/dev/smarty/compile/shopwarehouse/a9/94/a3/a994a3c5a500481515bc7b0596a4818bfcc60e9d_2.file.text.tpl.php
1367 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e5/37/94/e5379437e7cb07eac35c6b76d06b8bbdd09277e9_2.file.product-miniature-btn.tpl.php
1368 /var/cache/dev/smarty/compile/shopwarehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1369 /var/cache/dev/smarty/compile/shopwarehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
1370 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/4d/f5/a64df5b4b109264f55bc8c441b2ddd649e00fe0b_2.file.pagination.tpl.php
1371 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7d/c7/b9/7dc7b920724d67c85c9a1148ffc6e1352c81c741_2.file.products-bottom.tpl.php
1372 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1373 /var/cache/dev/smarty/compile/shopwarehouse/85/b4/27/85b427a04c9571c52bce3e03ca48c19c59f0ab89_2.file.related_posts_category.tpl.cache.php
1374 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1375 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1376 /var/cache/dev/smarty/cache/ybc_blog/7892/1/1/1/10/240508/shopwarehouse/ce/42/62/ce4262669d57a99fd312a58083a030ff04f2f417.related_posts_category.tpl.php
1377 /modules/ps_categorytree/ps_categorytree.php
1378 /var/cache/dev/smarty/compile/shopwarehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1379 /var/cache/dev/smarty/compile/shopwarehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1380 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/31/e3/1e/31e31e2f9e0e15e082e36c94e3ce506f8b52318b_2.file.footer.tpl.php
1381 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/59/d8/c5/59d8c5b4bd8f7dc7e77b4b784cf989309f96e9a6_2.file.footer-2.tpl.php
1382 /var/cache/dev/smarty/cache/iqithtmlandbanners/1/1/1/10/displayFooter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1383 /var/cache/dev/smarty/cache/iqitlinksmanager/1/1/1/10/displayFooter/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1384 /var/cache/dev/smarty/cache/iqitcontactpage/1/1/1/10/shopwarehouse/31/45/63/3145630ee48f34c64dce20915cd36a7d798fa52b.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1385 /var/cache/dev/smarty/compile/shopwarehouse/59/fa/4a/59fa4a468746e7397894d4d55728b7a0399415fc_2.file.artinvoice_js.tpl.php
1386 /var/cache/dev/smarty/compile/shopwarehouse/c8/59/18/c85918ff6d9da0aabb89af560f45f255349ce95e_2.file.footer.tpl.php
1387 /modules/lgcookieslaw/classes/LGCookiesLawCookie.php
1388 /classes/CMS.php
1389 /var/cache/dev/smarty/compile/b1/74/ee/b174ee22d35566f04bb92c3cdb14885c864f06e9_2.file.view_banner.tpl.php
1390 /var/cache/dev/smarty/compile/shopwarehouse/76/b6/77/76b677d100d34eed3ff7a027ae76cd2d2caafd5f_2.file.shinystat.tpl.php
1391 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f3/e2/01/f3e201110b395deed6ef05594261db3284242b23_2.file.footer-copyrights-1.tpl.php
1392 /var/cache/dev/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d2/ed/33/d2ed337060b8ed3aaacc807eb44ca9f06bc7740c_2.file.password-policy-template.tpl.php
1393 /classes/form/CustomerLoginForm.php
1394 /classes/form/AbstractForm.php
1395 /classes/form/FormInterface.php
1396 /src/Core/Foundation/Templating/RenderableInterface.php
1397 /classes/form/CustomerLoginFormatter.php
1398 /classes/form/FormFormatterInterface.php
1399 /classes/ValidateConstraintTranslator.php
1400 /src/Core/Util/InternationalizedDomainNameConverter.php
1401 /src/Core/Foundation/Templating/RenderableProxy.php
1402 /var/cache/dev/smarty/compile/shopwarehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1403 /classes/form/FormField.php
1404 /var/cache/dev/smarty/compile/shopwarehouse/22/1c/83/221c831891cf43068d82e5d2cedfd7083701554e_2.file.login-form.tpl.php
1405 /var/cache/dev/smarty/compile/shopwarehouse/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1406 /var/cache/dev/smarty/compile/8f/74/7a/8f747aa7caf4a60dae1415d8fc15828b2e6a2977_2.file.form-fields.tpl.php
1407 /var/cache/dev/smarty/compile/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1408 /var/cache/dev/smarty/compile/shopwarehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1409 /modules/statsdata/statsdata.php
1410 /classes/Guest.php
1411 /classes/Connection.php
1412 /classes/Page.php
1413 /classes/ConnectionsSource.php