prodotto aggiunto alla lista
Prodotto aggiunto per il confronto.
Load Time 1266 ms
Querying Time 996 ms
Queries 980
Memory Peak Usage 27.6 Mb
Included Files 1373 files - 17.77 Mb
PrestaShop Cache - Mb
Global vars 1.39 Mb
PrestaShop Version 8.1.5
PHP Version 8.1.28
MySQL Version 10.1.48-MariaDB-0ubuntu0.18.04.1
Memory Limit 1024M
Max Execution Time 300s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 10.521 ms 10.521 ms 5.94 Mb 6.7 Mb
__construct 0.017 ms 10.538 ms - Mb 6.7 Mb
init 31.195 ms 41.733 ms 1.34 Mb 7.6 Mb
checkAccess 0.003 ms 41.736 ms - Mb 7.6 Mb
setMedia 10.516 ms 52.252 ms 0.71 Mb 8.1 Mb
postProcess 0.002 ms 52.254 ms - Mb 8.1 Mb
initHeader 0.001 ms 52.255 ms - Mb 8.1 Mb
initContent 1112 ms 1165 ms 11.29 Mb 19.7 Mb
initFooter 0.002 ms 1165 ms - Mb 19.7 Mb
display 101.468 ms 1266 ms 7.27 Mb 27.6 Mb
Hook Time Memory Usage
DisplayHeader 220.543 ms 7.34 Mb
DisplayProductPriceBlock 15.187 ms 1.41 Mb
DisplayFooter 8.128 ms 0.39 Mb
DisplayBeforeBodyClosingTag 8.048 ms 0.17 Mb
ActionFrontControllerSetMedia 7.922 ms 0.60 Mb
DisplayAfterTitleTag 7.915 ms 0.92 Mb
displayLeftColumn 6.413 ms 0.08 Mb
displayBeforeBodyClosingTag 4.634 ms 0.50 Mb
DisplayFooterCategory 3.949 ms 0.10 Mb
DisplayTop 3.822 ms 0.16 Mb
displayNav2 3.689 ms 0.18 Mb
renderWidget 2.558 ms 0.14 Mb
Header 2.491 ms 0.15 Mb
displayFooter 2.057 ms 0.11 Mb
displayProductListReviews 1.848 ms 0.15 Mb
displayMainMenu 1.721 ms 0.85 Mb
displayNav1 1.435 ms 0.09 Mb
displayProductListFunctionalButtons 1.211 ms 0.01 Mb
displayNavCenter 1.082 ms 0.06 Mb
DisplayProductListReviews 0.907 ms 0.03 Mb
displayCategoryElementor 0.828 ms 0.08 Mb
DisplayAfterBodyOpeningTag 0.667 ms 0.04 Mb
DisplayLeftColumn 0.595 ms 0.06 Mb
IsJustElementor 0.374 ms 0.02 Mb
ProductSearchProvider 0.348 ms 0.01 Mb
displayAfterBreadcrumb 0.313 ms 0.04 Mb
DisplayFooterAfter 0.238 ms 0.01 Mb
ModuleRoutes 0.083 ms 0.03 Mb
OverrideLayoutTemplate 0.058 ms - Mb
displayVerticalMenu 0.014 ms - Mb
ActionFrontControllerInitAfter 0.012 ms - Mb
ActionDispatcher 0.012 ms - Mb
DisplayFooterBefore 0.009 ms - Mb
ActionProductSearchAfter 0.007 ms - Mb
34 hook(s) 309.118 ms 13.72 Mb
Module Time Memory Usage
doofinder 10.640 ms 1.72 Mb
ybc_blog 14.303 ms 0.64 Mb
simpleimportproduct 5.630 ms 0.35 Mb
ets_abandonedcart 1.899 ms 0.17 Mb
iqitthemeeditor 1.107 ms 0.26 Mb
ps_emailsubscription 0.674 ms 0.01 Mb
ps_emailalerts 0.332 ms 0.01 Mb
ps_checkout 7.761 ms 0.50 Mb
ps_accounts 0.336 ms - Mb
psrecaptcha 0.470 ms 0.17 Mb
revsliderprestashop 4.154 ms 0.03 Mb
arteinvoice 0.682 ms 0.03 Mb
lgcookieslaw 10.955 ms 0.57 Mb
ps_shoppingcart 0.177 ms 0.01 Mb
productcomments 0.167 ms 0.01 Mb
iqitcompare 2.279 ms 0.04 Mb
iqitcontactpage 1.562 ms 0.07 Mb
iqitcountdown 0.272 ms 0.01 Mb
iqitelementor 1.729 ms 0.11 Mb
iqitfreedeliverycount 0.279 ms 0.01 Mb
iqitmegamenu 2.030 ms 0.86 Mb
iqitreviews 2.000 ms 0.16 Mb
iqitwishlist 7.026 ms 0.55 Mb
iqitextendedproduct 0.222 ms 0.01 Mb
artproduttori 1.145 ms 0.05 Mb
ganalyticspro 191.793 ms 6.17 Mb
shinystat 0.661 ms 0.02 Mb
ets_integrategooglemarketing 0.787 ms 0.10 Mb
cdc_googletagmanager 8.680 ms 0.98 Mb
gremarketing 12.724 ms 0.55 Mb
gmerchantcenterpro 7.379 ms 0.38 Mb
connettore 0.694 ms 0.01 Mb
feedaty 5.217 ms 0.14 Mb
tec_dataminimizer 0.183 ms 0.01 Mb
ec_minorder 0.305 ms 0.01 Mb
multipleprices 13.394 ms 1.25 Mb
payplug 9.554 ms 0.45 Mb
sendinblue 0.524 ms 0.01 Mb
absfrequentlyboughttogether 0.275 ms 0.07 Mb
trustedprogramintegration 0.555 ms 0.01 Mb
ps_facetedsearch 1.108 ms 0.09 Mb
iqitlinksmanager 2.248 ms 0.13 Mb
iqithtmlandbanners 1.961 ms 0.08 Mb
ps_languageselector 0.522 ms 0.05 Mb
ps_currencyselector 0.554 ms 0.05 Mb
iqitsearch 2.174 ms 0.05 Mb
ps_customersignin 1.049 ms 0.08 Mb
pagesnotfound 0.105 ms 0.01 Mb
iqitproductsnav 0.706 ms 0.04 Mb
ps_categorytree 6.593 ms 0.10 Mb
statsdata 7.863 ms 0.17 Mb
51 module(s) 355.437 ms 17.30 Mb

Stopwatch SQL - 980 queries

# Query Time (ms) Rows Filesort Group By Location
623
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=337)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
22.079 ms 11130 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
651
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=363)) GROUP BY fp.id_feature_value
18.492 ms 23675520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
569
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 282 ORDER BY vl.`value` ASC
15.607 ms 1962 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
864
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 23613
ORDER BY `position`
10.671 ms 1 Yes /classes/Product.php:3545
617
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=330)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
10.462 ms 6360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
626
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=340)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
9.999 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
605
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=319)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
9.342 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
629
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=343)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
8.272 ms 2650 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
618
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=332)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
7.464 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
654
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=367)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
6.741 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
585
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=299)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
6.662 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
641
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=355)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
6.622 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
796
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=512)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
6.499 ms 9540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
868
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 23864
ORDER BY `position`
6.377 ms 1 Yes /classes/Product.php:3545
586
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=300)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
6.211 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
625
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=339)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.856 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
619
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=333)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.544 ms 25440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
628
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=342)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.535 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
815
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=532)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.439 ms 7420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
614
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=328)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.429 ms 23850 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
580
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=294)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
5.053 ms 20670 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
598
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=311)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.970 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
567
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 281 ORDER BY vl.`value` ASC
4.934 ms 561 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
2
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `uag_configuration` c
LEFT JOIN `uag_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
4.840 ms 2108 /classes/Configuration.php:180
631
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=345)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.715 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
604
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=318)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.587 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
658
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=371)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.437 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
573
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 287 ORDER BY vl.`value` ASC
4.405 ms 458 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
591
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=305)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.405 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
561
SELECT SQL_NO_CACHE m.*, ml.`description`, ml.`short_description`
FROM `uag_manufacturer` m INNER JOIN uag_manufacturer_shop manufacturer_shop
ON (manufacturer_shop.id_manufacturer = m.id_manufacturer AND manufacturer_shop.id_shop = 1)INNER JOIN `uag_manufacturer_lang` ml ON (m.`id_manufacturer` = ml.`id_manufacturer` AND ml.`id_lang` = 1)WHERE 1 AND m.`active` = 1 ORDER BY m.`name` ASC
4.402 ms 738 Yes /classes/Manufacturer.php:211
622
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=336)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.382 ms 9540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
642
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=356)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.341 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
640
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=354)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.232 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
634
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=348)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.203 ms 23850 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
90
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 57929) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
4.151 ms 1 /classes/stock/StockAvailable.php:453
805
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=521)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.067 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
775
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=491)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.034 ms 7420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
607
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=322)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
4.011 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
716
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=431)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.930 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
11
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `uag_lang` l
JOIN uag_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
3.866 ms 1 /classes/Language.php:1216
574
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=288)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.858 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
803
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=519)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.833 ms 9010 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
554
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936))
3.827 ms 14045 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
627
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=341)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.826 ms 17490 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
608
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=323)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.819 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
774
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=490)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.812 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
964
SELECT SQL_NO_CACHE c.id_parent, c.id_category, cl.name, cl.description, cl.link_rewrite
FROM `uag_category` c
INNER JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
INNER JOIN `uag_category_shop` cs ON (cs.`id_category` = c.`id_category` AND cs.`id_shop` = 1)
WHERE (c.`active` = 1 OR c.`id_category` = 2)
AND c.`id_category` != 1
AND `level_depth` <= 8
AND nleft >= 133 AND nright <= 156
AND c.id_category IN (
SELECT id_category
FROM `uag_category_group`
WHERE `id_group` IN (1)
)
ORDER BY `level_depth` ASC, cl.`name` ASC
3.795 ms 77 Yes /modules/ps_categorytree/ps_categorytree.php:166
643
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=357)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.660 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
636
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=350)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.638 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
637
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=351)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.608 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
597
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=310)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.591 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
565
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 280 ORDER BY vl.`value` ASC
3.560 ms 507 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
639
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=353)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.552 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
816
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=533)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.490 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
610
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=324)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.469 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
766
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=482)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.443 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
630
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=344)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.409 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
570
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=283)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.365 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
261
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23363 LIMIT 1
3.307 ms 1 /classes/SpecificPrice.php:435
762
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=478)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.276 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
581
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=295)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.275 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
584
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=298)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.269 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
649
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=362)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.264 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
566
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=281)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.250 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
663
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=376)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.250 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
620
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=334)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.241 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
773
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=489)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.209 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
579
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=293)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.201 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
589
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=303)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.187 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
644
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=358)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.181 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
571
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=284)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.162 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
715
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=430)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.127 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
755
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=471)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.116 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
13
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `uag_module` m
INNER JOIN uag_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `uag_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `uag_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `uag_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
3.106 ms 200 Yes Yes /classes/Hook.php:1233
664
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=377)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.101 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
718
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=433)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.091 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
587
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=301)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.087 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
653
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=366)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.068 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
635
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=349)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.055 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
613
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=327)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.039 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
576
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=290)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
3.004 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
588
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=302)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.998 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
656
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=369)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.997 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
647
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=361)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.983 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
621
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=335)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.959 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
767
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=483)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.947 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
575
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=289)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.944 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
697
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=412)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.935 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
74
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7878 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
2.921 ms 650 /classes/Category.php:1062
769
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=485)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.919 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
632
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=346)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.915 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
792
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=508)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.907 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
660
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=373)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.906 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
72
SELECT SQL_NO_CACHE * FROM uag_revslider_sliders
2.896 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
760
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=476)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.892 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
577
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=291)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.891 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
556
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
2.889 ms 718 Yes /classes/Category.php:724
582
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=296)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.884 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
595
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=308)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.884 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
578
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=292)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.883 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
568
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=282)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.871 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
768
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=484)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.836 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
583
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=297)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.833 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
590
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=304)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.824 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
602
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=316)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.807 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
633
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=347)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.806 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
695
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=410)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.803 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
557
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND cg.id_group='1' AND c.level_depth<=5 AND c.nleft>133 AND c.nright<156 GROUP BY cp.id_category
2.801 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
719
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=434)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.797 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
814
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=530)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.754 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
714
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=429)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.733 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
615
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=329)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.731 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
601
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=315)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.725 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
600
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=314)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.704 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
793
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=509)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.701 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
785
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=501)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.695 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
599
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=312)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.690 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
817
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=534)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.676 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
593
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=306)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.673 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
698
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=413)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.671 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
818
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=535)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.638 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
82
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `uag_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `uag_hook_alias` ha
INNER JOIN `uag_hook` h ON ha.name = h.name
2.621 ms 0 /classes/Hook.php:1292
562
SELECT SQL_NO_CACHE p.id_manufacturer, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) GROUP BY p.id_manufacturer
2.611 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
572
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=287)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.610 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
659
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=372)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.603 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
553
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC LIMIT 0, 36
2.596 ms 2809 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
753
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=469)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.582 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
560
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value=1936))
2.572 ms 5618 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
835
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=552)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.565 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
823
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=540)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.550 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
594
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=307)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.548 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
558
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value=1936))
2.526 ms 5618 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
783
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=499)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.517 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
829
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=546)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.506 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
721
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=436)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.491 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
670
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=384)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.489 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
967
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
2.477 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
784
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=500)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.474 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
666
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=379)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.451 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
596
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=309)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.449 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
559
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value=1936))
2.444 ms 5618 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
828
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=545)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.438 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
692
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=407)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.436 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
624
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=338)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.423 ms 13250 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
564
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=280)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.411 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
549
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `uag_feature` f  INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `uag_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
2.397 ms 280 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
83
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `uag_hook_module` hm
STRAIGHT_JOIN `uag_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `uag_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
2.389 ms 645 /classes/Hook.php:456
745
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=461)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.389 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
646
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=360)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.369 ms 14310 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
728
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=444)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.361 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
611
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=325)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.357 ms 4770 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
761
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=477)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.334 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
672
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=386)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.332 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
661
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=374)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.312 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
689
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=403)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.284 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
648
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 361 ORDER BY vl.`value` ASC
2.242 ms 210 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
722
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=437)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.192 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
706
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=421)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.166 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
786
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=502)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.157 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
699
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=414)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.147 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
794
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=510)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.127 ms 19610 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
682
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=396)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.117 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
667
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=380)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.090 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
974
INSERT INTO `uag_guest` (`id_operating_system`, `id_web_browser`, `id_customer`, `javascript`, `screen_resolution_x`, `screen_resolution_y`, `screen_color`, `sun_java`, `adobe_flash`, `adobe_director`, `apple_quicktime`, `real_player`, `windows_media`, `accept_language`, `mobile_theme`) VALUES ('0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '0', '', '0')
2.068 ms 1 /classes/ObjectModel.php:622
724
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=439)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.060 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
543
SELECT SQL_NO_CACHE p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, 0) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, 0) AS id_product_attribute,
product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
DATEDIFF(product_shop.`date_add`, DATE_SUB("2024-05-08 00:00:00",
INTERVAL 20 DAY)) > 0 AS new, product_shop.price AS orderprice
FROM `uag_category_product` cp
LEFT JOIN `uag_product` p
ON p.`id_product` = cp.`id_product`
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = 1 AND product_attribute_shop.id_shop=1)
LEFT JOIN uag_stock_available stock
ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = 0 AND stock.id_shop = 1  AND stock.id_shop_group = 0  )
LEFT JOIN `uag_category_lang` cl
ON (product_shop.`id_category_default` = cl.`id_category`
AND cl.`id_lang` = 1 AND cl.id_shop = 1 )
LEFT JOIN `uag_product_lang` pl
ON (p.`id_product` = pl.`id_product`
AND pl.`id_lang` = 1 AND pl.id_shop = 1 )
LEFT JOIN `uag_image_shop` image_shop
ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=1 AND image_shop.id_shop=1)
LEFT JOIN `uag_image_lang` il
ON (image_shop.`id_image` = il.`id_image`
AND il.`id_lang` = 1)
LEFT JOIN `uag_manufacturer` m
ON m.`id_manufacturer` = p.`id_manufacturer`
WHERE product_shop.`id_shop` = 1
AND cp.`id_category` = 7878 AND product_shop.`active` = 1 AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
LIMIT 0,24
2.044 ms 650 /classes/Category.php:1062
680
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=394)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.018 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
669
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=383)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.012 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
243
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23361 LIMIT 1
2.009 ms 1 /classes/SpecificPrice.php:435
746
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=462)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
2.008 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
638
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=352)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.998 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
668
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=382)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.937 ms 5618 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
804
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=520)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.923 ms 17490 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
612
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=326)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.920 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
340
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23346
1.881 ms 1 /classes/Tag.php:244
810
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=526)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.861 ms 3180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
830
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=547)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.823 ms 6890 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
819
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=536)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.821 ms 17490 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
657
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=370)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.743 ms 16960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
841
REPLACE INTO uag_layered_filter_block (hash, data) VALUES ("6963814f1e7cd5dba3b93f1cd00e0d69", "a:1:{s:7:\"filters\";a:14:{i:0;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:9:\"Categorie\";s:6:\"values\";a:1:{i:8153;a:2:{s:4:\"name\";s:33:\"etichette carta copy-laser-inkjet\";s:3:\"nbr\";i:2;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:1;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilità\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:12:\"In magazzino\";s:3:\"nbr\";i:2;}i:0;a:2:{s:4:\"name\";s:15:\"Non disponibile\";s:3:\"nbr\";i:0;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:2;a:7:{s:9:\"type_lite\";s:12:\"manufacturer\";s:4:\"type\";s:12:\"manufacturer\";s:6:\"id_key\";i:0;s:4:\"name\";s:5:\"Marca\";s:6:\"values\";a:2:{i:59955;a:2:{s:4:\"name\";s:6:\"Markin\";s:3:\"nbr\";i:1;}i:69154;a:2:{s:4:\"name\";s:8:\"Starline\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:3;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:6:\"Prezzo\";s:3:\"max\";d:9;s:3:\"min\";d:7;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:1:\".\";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:2;s:5:\"value\";N;}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:280;s:6:\"values\";a:1:{i:50;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:6:\"Bianco\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Colore\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:281;s:6:\"values\";a:1:{i:740;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:5:\"Carta\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Materiale\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:6;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:282;s:6:\"values\";a:1:{i:67011;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:28:\"Etichette adesive permanenti\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:9:\"Tipologia\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:7;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:287;s:6:\"values\";a:1:{i:25;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:14:\"A4 (21x29,7cm)\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:7:\"Formato\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:8;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:305;s:6:\"values\";a:1:{i:794;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:19:\"Laser, inkjet, copy\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:6:\"Stampa\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:9;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:323;s:6:\"values\";a:0:{}s:4:\"name\";s:8:\"Utilizzi\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:10;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:329;s:6:\"values\";a:1:{i:603;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:9:\"100 fogli\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:10:\"Confezione\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:11;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:361;s:6:\"values\";a:1:{i:65427;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:13:\"52,5 x 21,2mm\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:20:\"Dimensione etichette\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:12;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:362;s:6:\"values\";a:0:{}s:4:\"name\";s:7:\"Adesivo\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}i:13;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";i:363;s:6:\"values\";a:27:{i:789;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:1:\"3\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:816;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:1:\"5\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:825;a:4:{s:3:\"nbr\";i:12;s:4:\"name\";s:2:\"14\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:770;a:4:{s:3:\"nbr\";i:14;s:4:\"name\";s:2:\"15\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:807;a:4:{s:3:\"nbr\";i:23;s:4:\"name\";s:2:\"16\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:804;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:2:\"18\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:768;a:4:{s:3:\"nbr\";i:17;s:4:\"name\";s:2:\"21\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:799;a:4:{s:3:\"nbr\";i:6;s:4:\"name\";s:2:\"27\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:764;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:2:\"28\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:773;a:4:{s:3:\"nbr\";i:9;s:4:\"name\";s:2:\"30\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1962;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:2:\"32\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:759;a:4:{s:3:\"nbr\";i:4;s:4:\"name\";s:2:\"35\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:762;a:4:{s:3:\"nbr\";i:9;s:4:\"name\";s:2:\"40\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1185;a:4:{s:3:\"nbr\";i:5;s:4:\"name\";s:2:\"42\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1746;a:4:{s:3:\"nbr\";i:11;s:4:\"name\";s:2:\"44\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:754;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:2:\"49\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1936;a:5:{s:3:\"nbr\";i:2;s:4:\"name\";s:2:\"56\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:1727;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:2:\"60\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:750;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:2:\"63\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:945;a:4:{s:3:\"nbr\";i:7;s:4:\"name\";s:2:\"65\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:797;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:2:\"72\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5192;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:2:\"75\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:5494;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:2:\"77\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:947;a:4:{s:3:\"nbr\";i:3;s:4:\"name\";s:2:\"84\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1939;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:2:\"88\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:1847;a:4:{s:3:\"nbr\";i:2;s:4:\"name\";s:3:\"189\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:2767;a:4:{s:3:\"nbr\";i:1;s:4:\"name\";s:3:\"280\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:20:\"Etichette per foglio\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:0;}}}")
1.713 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
334
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.707 ms 1 /classes/stock/StockAvailable.php:753
655
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=368)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.695 ms 13780 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
606
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=320)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.672 ms 24380 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
242
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
1.671 ms 1 /classes/Product.php:5655
23
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*
FROM `uag_feature` f
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
LEFT JOIN `uag_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1)
ORDER BY f.`position` ASC
1.647 ms 280 Yes /classes/Feature.php:92
338
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23346
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
1.644 ms 0 /classes/Product.php:1732
979
INSERT INTO `uag_connections_source` (`id_connections`, `http_referer`, `request_uri`, `keywords`, `date_add`) VALUES ('664', '', 'www.angoloufficio.it/7878-etichette-prezzatrici-cartelli?q=Etichette+per+foglio-56&resultsPerPage=36', '', '2024-05-08 14:25:18')
1.629 ms 1 /classes/ObjectModel.php:622
693
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=408)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.616 ms 22260 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
547
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7878
AND `id_shop` = 1 LIMIT 1
1.595 ms 1 /classes/Category.php:2450
603
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=317)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.588 ms 24380 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
321
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23344
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
1.583 ms 0 /classes/Product.php:1732
694
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=409)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.539 ms 7950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
802
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=518)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.510 ms 14310 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
696
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=411)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.507 ms 25970 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
824
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=541)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.496 ms 12720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
720
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=435)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.492 ms 10070 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
776
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=492)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.492 ms 25440 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
770
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=486)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.474 ms 7420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
961
SELECT SQL_NO_CACHE p.*,pc.id_category, pl.image,pl.thumb, pl.title, pl.description, pl.short_description, pl.meta_keywords, pl.meta_description,pl.url_alias,e.firstname, e.lastname,pc.position,count(pcm.id_comment) as total_comment,IFNULL(ybe.status,1) as status
FROM `uag_ybc_blog_post` p
INNER JOIN `uag_ybc_blog_post_shop` ps ON (p.id_post=ps.id_post AND ps.id_shop='1')
LEFT JOIN `uag_ybc_blog_post_lang` pl ON p.id_post = pl.id_post AND pl.id_lang = 1
LEFT JOIN `uag_ybc_blog_post_category` pc ON (p.id_post = pc.id_post ) 
LEFT JOIN `uag_ybc_blog_post_related_categories` rpc ON (p.id_post = rpc.id_post)
LEFT JOIN `uag_customer` c ON (c.id_customer=p.added_by AND p.is_customer=1)
LEFT JOIN `uag_employee` e ON (e.id_employee=p.added_by AND p.is_customer=0)
LEFT JOIN `uag_ybc_blog_employee` ybe ON ((ybe.id_employee=c.id_customer AND ybe.is_customer=1) OR (ybe.id_employee=e.id_employee AND ybe.is_customer=0))
LEFT JOIN `uag_ybc_blog_comment` pcm on (pcm.id_post=p.id_post)
WHERE 1  AND p.enabled=1 AND rpc.id_category=7878  
GROUP BY p.id_post
ORDER BY p.datetime_added DESC,  p.id_post DESC  LIMIT 0, 6
1.474 ms 1 Yes /modules/ybc_blog/classes/ybc_blog_post_class.php:262
801
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=517)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.465 ms 14840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
662
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=375)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.460 ms 10600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
563
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM uag_product p INNER JOIN uag_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 10) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156
1.456 ms 53 /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
28
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7878) AND (b.`id_shop` = 1) LIMIT 1
1.442 ms 1 /src/Adapter/EntityMapper.php:71
978
INSERT INTO `uag_connections` (`id_guest`, `id_page`, `ip_address`, `http_referer`, `id_shop`, `id_shop_group`, `date_add`) VALUES ('855', '3900', '316498503', '', '1', '1', '2024-05-08 14:25:18')
1.438 ms 1 /classes/ObjectModel.php:622
799
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=515)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.436 ms 18550 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
798
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=514)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.435 ms 20140 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
807
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=523)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.422 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
806
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=522)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.416 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
797
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=513)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.416 ms 18550 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
645
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=359)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.415 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
673
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=387)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.394 ms 16430 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23361 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23361 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
1.393 ms 0 /classes/Cart.php:1423
800
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=516)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.385 ms 14310 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
809
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=525)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.352 ms 5830 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
836
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=553)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.348 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
690
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=405)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.337 ms 18020 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
777
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=493)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.321 ms 13250 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
831
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=548)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.313 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
308
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 57929 AND `id_shop` = 1
1.312 ms 1 /src/Adapter/EntityMapper.php:79
686
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=400)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.308 ms 12190 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
771
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=487)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.296 ms 4770 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
616
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 329 ORDER BY vl.`value` ASC
1.284 ms 96 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
726
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=441)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.279 ms 14310 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
772
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=488)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.277 ms 4770 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
820
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=537)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.275 ms 18550 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
812
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=528)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.264 ms 2650 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
779
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=495)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.263 ms 21730 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
12
SELECT SQL_NO_CACHE lower(name) as name
FROM `uag_hook` h
WHERE (h.active = 1)
1.261 ms 1128 /classes/Hook.php:1332
795
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=511)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.260 ms 9010 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
822
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=539)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.255 ms 17490 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
688
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=402)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.246 ms 12190 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
49
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8160) AND (b.`id_shop` = 1) LIMIT 1
1.244 ms 1 /src/Adapter/EntityMapper.php:71
811
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=527)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.237 ms 4770 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
687
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=401)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.222 ms 7950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
789
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=505)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.219 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
717
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=432)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.216 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
756
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=472)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.216 ms 23320 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
173
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
1.210 ms 1 /classes/stock/StockAvailable.php:453
763
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=479)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.209 ms 6890 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
691
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=406)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.194 ms 19080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
821
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=538)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.194 ms 19080 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
833
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=550)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.192 ms 3180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
708
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=423)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.186 ms 24910 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
813
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=529)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.186 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
790
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=506)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.185 ms 3180 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
675
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=389)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.178 ms 12190 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
727
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=443)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.178 ms 5300 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
674
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=388)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.177 ms 13250 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
665
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=378)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.168 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
522
SHOW TABLES LIKE "uag_gmcp_1800"
1.158 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
747
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=463)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.155 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
681
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=395)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.153 ms 7950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
744
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=460)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.150 ms 9540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
711
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=426)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.148 ms 24380 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
729
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=445)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.145 ms 6360 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
826
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=543)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.139 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
791
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=507)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.136 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
115
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23346 LIMIT 1
1.134 ms 1 /classes/SpecificPrice.php:435
743
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=459)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.131 ms 3710 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
759
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=475)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.129 ms 18550 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
712
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=427)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.129 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
827
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=544)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.123 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
838
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=555)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.116 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
780
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=496)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.112 ms 21200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
808
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=524)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.107 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
678
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=392)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.103 ms 15370 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
723
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=438)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.102 ms 12720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
707
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=422)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.096 ms 7950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
683
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=397)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.094 ms 4240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
685
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=399)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.093 ms 24910 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
700
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=415)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.091 ms 12720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
757
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=473)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.086 ms 21730 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
713
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=428)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.074 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
730
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=446)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.072 ms 22790 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
758
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=474)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.070 ms 17490 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
684
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=398)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.067 ms 4240 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
832
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=549)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.064 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
376
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23351) LIMIT 1
1.062 ms 1 /src/Adapter/EntityMapper.php:71
734
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=450)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.062 ms 24910 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
825
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=542)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.059 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
840
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=561)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.059 ms 3710 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
190
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23355 AND id_shop=1 LIMIT 1
1.054 ms 1 /classes/Product.php:6870
778
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=494)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.051 ms 22260 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
788
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=504)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.051 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
839
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=560)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.051 ms 7950 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
742
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=458)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.045 ms 12720 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
781
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=497)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.045 ms 16960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
765
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=481)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.035 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
704
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=419)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.031 ms 16430 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
764
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=480)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.029 ms 9010 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
725
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=440)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.028 ms 13250 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
701
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=416)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.027 ms 13780 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
609
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 323 ORDER BY vl.`value` ASC
1.022 ms 22 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
754
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=470)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.015 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
733
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=449)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
1.002 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
120
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23346 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23346 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.998 ms 0 /classes/Cart.php:1423
751
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=467)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.996 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
752
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=468)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.985 ms 16960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
732
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=448)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.983 ms 8480 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
43
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `uag_category` c
INNER JOIN uag_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `uag_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 7878
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.981 ms 11 Yes Yes /classes/Category.php:924
705
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=420)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.971 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
787
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=503)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.971 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
671
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=385)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.967 ms 2650 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
514
DESCRIBE uag_ybc_blog_post
0.966 ms 1 /modules/ybc_blog/ybc_blog_defines.php:3141
738
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=454)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.964 ms 16960 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
703
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=418)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.949 ms 10600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
735
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=451)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.947 ms 15900 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
782
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=498)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.944 ms 9010 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
709
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=424)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.939 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
710
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=425)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.938 ms 7420 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
548
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM uag_layered_category
WHERE controller = 'category'
AND id_category = 7878
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.937 ms 270 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
837
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=554)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.935 ms 1060 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23361
ORDER BY f.position ASC
0.930 ms 5 Yes /classes/Product.php:6015
737
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=453)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.928 ms 11660 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
677
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=391)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.923 ms 9540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
736
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=452)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.923 ms 11660 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
834
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=551)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.914 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
702
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=417)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.904 ms 2120 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
731
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=447)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.904 ms 5830 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
749
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=465)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.904 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
750
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=466)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.894 ms 1590 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
748
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=464)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.884 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
679
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=393)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.883 ms 9540 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
741
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=457)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.880 ms 11660 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
676
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=390)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.877 ms 6890 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
739
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=455)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.874 ms 4770 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23361)
0.872 ms 1 /classes/Product.php:3860
740
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=1936)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=133 AND c.nright<=156 GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=456)) AND ((fp_1.id_feature_value=1936)) GROUP BY fp.id_feature_value
0.856 ms 530 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:86
84
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.838 ms 2 Yes /classes/tax/TaxRulesTaxManager.php:109
266
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23363 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23363 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.813 ms 0 /classes/Cart.php:1423
533
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'IT' LIMIT 1
0.798 ms 1 /classes/Country.php:194
862
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23864
ORDER BY f.position ASC
0.797 ms 10 Yes /classes/Product.php:6015
19
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.738 ms 128 /classes/module/Module.php:345
202
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23356 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23356 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.711 ms 0 /classes/Cart.php:1423
652
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 363 ORDER BY vl.`value` ASC
0.708 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
148
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23349
ORDER BY f.position ASC
0.692 ms 4 Yes /classes/Product.php:6015
20
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.683 ms 1 Yes Yes /classes/Supplier.php:139
842
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2024-05-08 00:00:00',
INTERVAL 20 DAY
)
) > 0) as new
FROM uag_product p
LEFT JOIN uag_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN uag_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN uag_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (23613,23864)
0.679 ms 2 /classes/ProductAssembler.php:95
15
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `uag_hook`
0.675 ms 1128 /classes/Hook.php:1292
867
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23864) AND (b.`id_shop` = 1) LIMIT 1
0.657 ms 1 /src/Adapter/EntityMapper.php:71
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.648 ms 128 /classes/module/Module.php:345
126
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23347 AND id_shop=1 LIMIT 1
0.647 ms 1 /classes/Product.php:6870
531
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1)
0.646 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:91
299
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23370) AND (b.`id_shop` = 1) LIMIT 1
0.644 ms 1 /src/Adapter/EntityMapper.php:71
960
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69154, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.638 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
116
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23346)
0.615 ms 1 /classes/Product.php:3860
102
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23344 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23344 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.613 ms 0 /classes/Cart.php:1423
307
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 57929) LIMIT 1
0.603 ms 1 /src/Adapter/EntityMapper.php:71
258
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23362
ORDER BY f.position ASC
0.598 ms 5 Yes /classes/Product.php:6015
507
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.589 ms 1 /classes/stock/StockAvailable.php:806
404
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23355
0.580 ms 1 /classes/Tag.php:244
157
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23350
ORDER BY f.position ASC
0.578 ms 4 Yes /classes/Product.php:6015
94
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23344
AND image_shop.`cover` = 1 LIMIT 1
0.574 ms 1 /classes/Product.php:3570
16
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.573 ms 128 /classes/module/Module.php:345
239
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23360 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23360 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.573 ms 0 /classes/Cart.php:1423
306
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23370
ORDER BY f.position ASC
0.560 ms 9 Yes /classes/Product.php:6015
91
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 57929 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 57929 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.553 ms 0 /classes/Cart.php:1423
305
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23370 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23370 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.548 ms 0 /classes/Cart.php:1423
57
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.545 ms 3 /classes/CartRule.php:357
852
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23613
ORDER BY f.position ASC
0.544 ms 10 Yes /classes/Product.php:6015
314
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 57929) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.543 ms 1 /classes/stock/StockAvailable.php:778
119
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.542 ms 1 /classes/stock/StockAvailable.php:453
863
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23613) AND (b.`id_shop` = 1) LIMIT 1
0.541 ms 1 /src/Adapter/EntityMapper.php:71
271
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23364)
0.536 ms 1 /classes/Product.php:3860
353
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23348 AND `id_shop` = 1
0.536 ms 1 /src/Adapter/EntityMapper.php:79
75
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 57929
AND image_shop.`cover` = 1 LIMIT 1
0.527 ms 1 /classes/Product.php:3570
516
SELECT SQL_NO_CACHE ac.id_ets_abancart_campaign
FROM `uag_ets_abancart_campaign` ac
LEFT JOIN `uag_ets_abancart_campaign_country` `cc` ON cc.id_ets_abancart_campaign = ac.id_ets_abancart_campaign
LEFT JOIN `uag_ets_abancart_campaign_with_lang` `cl` ON cl.id_ets_abancart_campaign = ac.id_ets_abancart_campaign AND cl.id_lang=1
LEFT JOIN `uag_ets_abancart_campaign_group` `acg` ON ac.id_ets_abancart_campaign = acg.id_ets_abancart_campaign
LEFT JOIN `uag_group_shop` `gs` ON gs.id_group = acg.id_group AND gs.id_shop = 1
WHERE (ac.id_shop = 1) AND (ac.enabled = 1 AND ac.deleted = 0) AND (IF(ac.is_all_lang != 1, cl.id_ets_abancart_campaign is NOT NULL AND cl.id_lang=1, 1)) AND (ac.campaign_type != 'email') AND (ac.campaign_type != 'customer') AND (IF(ac.min_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.min_total_cart <= 0, 1) AND IF(ac.max_total_cart is NOT NULL AND ac.has_product_in_cart = 1, ac.max_total_cart >= 0, 1)) AND (IF(ac.available_from is NOT NULL, ac.available_from <= '2024-05-08', 1) AND IF(ac.available_to is NOT NULL, ac.available_to >= '2024-05-08', 1)) AND (IF(ac.has_applied_voucher = 'both' OR (ac.has_applied_voucher = 'yes' AND 0 > 0) OR (ac.has_applied_voucher = 'no' AND 0 = 0), 1, 0)) AND (IF(ac.has_product_in_cart = 1, 0, 1)) AND (acg.id_group = 1) AND (ac.is_all_country = 1 OR cc.id_country = -1 OR cc.id_country=10)
GROUP BY ac.id_ets_abancart_campaign
0.523 ms 1 Yes /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:407
267
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23363
ORDER BY f.position ASC
0.522 ms 5 Yes /classes/Product.php:6015
230
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23359 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23359 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.521 ms 0 /classes/Cart.php:1423
211
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23357 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23357 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.519 ms 0 /classes/Cart.php:1423
25
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `uag_meta` m
LEFT JOIN `uag_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.518 ms 64 Yes /classes/Dispatcher.php:654
56
SELECT SQL_NO_CACHE 1 FROM uag_cart_product cp INNER JOIN uag_product p
ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps
ON (ps.id_shop = cp.id_shop AND ps.id_product = p.id_product) WHERE cp.id_cart=0 LIMIT 1
0.517 ms 1 /classes/Cart.php:4210
490
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23366) LIMIT 1
0.514 ms 1 /src/Adapter/EntityMapper.php:71
27
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.511 ms 128 /classes/module/Module.php:345
482
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23365) LIMIT 1
0.502 ms 1 /src/Adapter/EntityMapper.php:71
851
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23613 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23613 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.502 ms 0 /classes/Cart.php:1423
495
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23366) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.500 ms 1 /classes/stock/StockAvailable.php:778
384
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23352) LIMIT 1
0.497 ms 1 /src/Adapter/EntityMapper.php:71
284
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23365 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23365 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.496 ms 0 /classes/Cart.php:1423
92
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 57929
ORDER BY f.position ASC
0.491 ms 11 Yes /classes/Product.php:6015
174
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23352 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23352 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.491 ms 0 /classes/Cart.php:1423
933
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 23613
0.489 ms 3 /classes/Product.php:3423
377
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23351 AND `id_shop` = 1
0.480 ms 1 /src/Adapter/EntityMapper.php:79
394
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23354
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.480 ms 0 /classes/Product.php:1732
861
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23864 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23864 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.477 ms 0 /classes/Cart.php:1423
103
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23344
ORDER BY f.position ASC
0.474 ms 4 Yes /classes/Product.php:6015
344
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23347) LIMIT 1
0.467 ms 1 /src/Adapter/EntityMapper.php:71
71
SELECT SQL_NO_CACHE a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = 1)
WHERE (a.`id_shop` = 1) AND (a.`active` = 1)
0.467 ms 5 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php:354
17
SELECT SQL_NO_CACHE name, alias FROM `uag_hook_alias`
0.466 ms 88 /classes/Hook.php:339
262
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23363)
0.464 ms 1 /classes/Product.php:3860
497
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23366) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.464 ms 1 /classes/stock/StockAvailable.php:806
909
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitsearch" LIMIT 1
0.462 ms 1 /classes/module/Module.php:2636
948
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (23864) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.460 ms 1 Yes Yes /classes/Product.php:4520
86
SELECT SQL_NO_CACHE *
FROM `uag_tax_lang`
WHERE `id_tax` = 1
0.455 ms 1 /src/Adapter/EntityMapper.php:79
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `uag_module` m
LEFT JOIN `uag_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.453 ms 128 /classes/module/Module.php:345
112
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23345
ORDER BY f.position ASC
0.452 ms 4 Yes /classes/Product.php:6015
138
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23348 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23348 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.452 ms 0 /classes/Cart.php:1423
156
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23350 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23350 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1423
184
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23354 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23354 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.451 ms 0 /classes/Cart.php:1423
929
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `uag_product_attribute` pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (23613) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.447 ms 1 Yes Yes /classes/Product.php:4520
592
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 305 ORDER BY vl.`value` ASC
0.446 ms 8 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
185
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23354
ORDER BY f.position ASC
0.445 ms 4 Yes /classes/Product.php:6015
240
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23360
ORDER BY f.position ASC
0.445 ms 5 Yes /classes/Product.php:6015
21
SELECT SQL_NO_CACHE s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = 1
INNER JOIN uag_supplier_shop supplier_shop
ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = 1)
WHERE (s.`active` = 1)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
0.438 ms 1 Yes Yes /classes/Supplier.php:139
142
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23349 LIMIT 1
0.438 ms 1 /classes/SpecificPrice.php:435
122
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23347
AND image_shop.`cover` = 1 LIMIT 1
0.431 ms 1 /classes/Product.php:3570
3
SELECT SQL_NO_CACHE *
FROM `uag_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.429 ms 1 /src/Adapter/EntityMapper.php:71
505
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.428 ms 1 /classes/stock/StockAvailable.php:778
550
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 363 ORDER BY vl.`value` ASC
0.424 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
532
SELECT SQL_NO_CACHE *
FROM `uag_gmcp_feeds` ff
WHERE (ff.iso_lang="it") AND (ff.id_shop=1)
0.419 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:109
932
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(59955, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.417 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
947
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 23864 LIMIT 1
0.416 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
30
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.414 ms 1 /classes/Language.php:883
336
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23346) LIMIT 1
0.412 ms 1 /src/Adapter/EntityMapper.php:71
499
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23370) LIMIT 1
0.410 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23352
ORDER BY f.position ASC
0.410 ms 4 Yes /classes/Product.php:6015
111
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23345 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23345 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.409 ms 0 /classes/Cart.php:1423
121
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23346
ORDER BY f.position ASC
0.408 ms 4 Yes /classes/Product.php:6015
29
SELECT SQL_NO_CACHE * FROM `uag_currency` c ORDER BY `iso_code` ASC
0.407 ms 1 Yes /classes/Currency.php:709
650
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 362 ORDER BY vl.`value` ASC
0.407 ms 2 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
50
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8167) AND (b.`id_shop` = 1) LIMIT 1
0.405 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23359
ORDER BY f.position ASC
0.405 ms 5 Yes /classes/Product.php:6015
968
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 1) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.405 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
203
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23356
ORDER BY f.position ASC
0.404 ms 4 Yes /classes/Product.php:6015
194
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23355
ORDER BY f.position ASC
0.403 ms 4 Yes /classes/Product.php:6015
352
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23348) LIMIT 1
0.398 ms 1 /src/Adapter/EntityMapper.php:71
938
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(59955, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.397 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
432
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23359) LIMIT 1
0.396 ms 1 /src/Adapter/EntityMapper.php:71
975
SELECT SQL_NO_CACHE `id_guest`
FROM `uag_connections`
WHERE `id_guest` = 855
AND `date_add` > '2024-05-08 13:55:00'
AND id_shop IN (1) 
ORDER BY `date_add` DESC LIMIT 1
0.396 ms 1 Yes /classes/Connection.php:168
212
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23357
ORDER BY f.position ASC
0.395 ms 4 Yes /classes/Product.php:6015
147
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23349 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23349 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.394 ms 0 /classes/Cart.php:1423
965
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcontactpage" LIMIT 1
0.392 ms 1 /classes/module/Module.php:2636
875
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 133 AND c.`nright` >= 156 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.389 ms 68 /classes/Category.php:1600
506
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.389 ms 1 /classes/stock/StockAvailable.php:753
189
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23355)
0.387 ms 1 /classes/Product.php:3860
193
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23355 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23355 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.387 ms 0 /classes/Cart.php:1423
275
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23364 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23364 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.386 ms 0 /classes/Cart.php:1423
285
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23365
ORDER BY f.position ASC
0.385 ms 5 Yes /classes/Product.php:6015
98
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23344)
0.384 ms 1 /classes/Product.php:3860
222
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23359
AND image_shop.`cover` = 1 LIMIT 1
0.383 ms 3 /classes/Product.php:3570
113
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23346
AND image_shop.`cover` = 1 LIMIT 1
0.382 ms 1 /classes/Product.php:3570
178
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23354) AND (b.`id_shop` = 1) LIMIT 1
0.382 ms 1 /src/Adapter/EntityMapper.php:71
966
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 73 AND `id_shop` = 1 LIMIT 1
0.381 ms 1 /classes/module/Module.php:2109
392
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23354) LIMIT 1
0.378 ms 1 /src/Adapter/EntityMapper.php:71
70
SELECT SQL_NO_CACHE *
FROM `uag_category` a0
LEFT JOIN `uag_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 133) AND (a0.`nright` > 156) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.377 ms 68 /classes/PrestaShopCollection.php:383
386
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23352
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.376 ms 0 /classes/Product.php:1732
109
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23345 AND `id_group` = 1 LIMIT 1
0.375 ms 0 /classes/GroupReduction.php:156
59
SELECT SQL_NO_CACHE 1 FROM `uag_cart_rule` WHERE ((date_to >= "2024-05-08 00:00:00" AND date_to <= "2024-05-08 23:59:59") OR (date_from >= "2024-05-08 00:00:00" AND date_from <= "2024-05-08 23:59:59") OR (date_from < "2024-05-08 00:00:00" AND date_to > "2024-05-08 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.374 ms 3 /classes/CartRule.php:357
139
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23348
ORDER BY f.position ASC
0.373 ms 4 Yes /classes/Product.php:6015
470
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23363
0.370 ms 1 /classes/Tag.php:244
276
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23364
ORDER BY f.position ASC
0.369 ms 5 Yes /classes/Product.php:6015
846
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23613 LIMIT 1
0.367 ms 1 /classes/SpecificPrice.php:435
257
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23362 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23362 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.366 ms 0 /classes/Cart.php:1423
93
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.365 ms 1 Yes /classes/tax/TaxRulesTaxManager.php:109
220
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23358 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23358 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.365 ms 0 /classes/Cart.php:1423
0
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM uag_shop_url su
LEFT JOIN uag_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'www.angoloufficio.it' OR su.domain_ssl = 'www.angoloufficio.it')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.364 ms 1 Yes /classes/shop/Shop.php:1364
247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.364 ms 1 /classes/stock/StockAvailable.php:453
165
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23351 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23351 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.363 ms 0 /classes/Cart.php:1423
900
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 71 AND `id_shop` = 1 LIMIT 1
0.359 ms 1 /classes/module/Module.php:2109
360
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23349) LIMIT 1
0.358 ms 1 /src/Adapter/EntityMapper.php:71
130
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23347
ORDER BY f.position ASC
0.357 ms 4 Yes /classes/Product.php:6015
129
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23347 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23347 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.357 ms 0 /classes/Cart.php:1423
400
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23355) LIMIT 1
0.355 ms 1 /src/Adapter/EntityMapper.php:71
152
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23350)
0.354 ms 1 /classes/Product.php:3860
895
SELECT SQL_NO_CACHE c.*, cl.*  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`nleft` <= 133 AND c.`nright` >= 156 AND c.`nleft` >= 2 AND c.`nright` <= 1435 ORDER BY `nleft` DESC
0.354 ms 68 /classes/Category.php:1600
226
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23359)
0.351 ms 1 /classes/Product.php:3860
424
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23358) LIMIT 1
0.351 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23350) LIMIT 1
0.349 ms 1 /src/Adapter/EntityMapper.php:71
60
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.349 ms 1 /classes/CartRule.php:423
977
SELECT SQL_NO_CACHE `id_page`
FROM `uag_page`
WHERE `id_page_type` = 7 AND `id_object` = 7878 LIMIT 1
0.346 ms 1 /classes/Page.php:83
55
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_accounts" LIMIT 1
0.345 ms 1 /src/Adapter/Module/ModuleDataProvider.php:257
330
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23345
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.344 ms 0 /classes/Product.php:1732
913
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171118
0.344 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
63
SELECT SQL_NO_CACHE * FROM `uag_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.343 ms 8 Yes /classes/ImageType.php:109
509
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund` gf
WHERE (gf.shop_id=1) AND (gf.sent= "0") LIMIT 1
0.341 ms 1 /modules/ganalyticspro/models/orderRefund.php:105
956
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69154, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.332 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
517
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenterpro" LIMIT 1
0.330 ms 1 /classes/module/Module.php:2636
415
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.329 ms 1 /classes/stock/StockAvailable.php:806
253
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23362)
0.328 ms 1 /classes/Product.php:3860
80
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 57929)
0.327 ms 1 /classes/Product.php:3860
14
SELECT SQL_NO_CACHE `name`, `alias` FROM `uag_hook_alias`
0.327 ms 88 /classes/Hook.php:287
221
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23358
ORDER BY f.position ASC
0.326 ms 4 Yes /classes/Product.php:6015
951
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(69154, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.325 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT cp.`quantity` as first_level_quantity, 0 as pack_quantity
FROM `uag_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 23366 UNION SELECT 0 as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_customization` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 23366 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.323 ms 0 /classes/Cart.php:1423
166
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23351
ORDER BY f.position ASC
0.323 ms 4 Yes /classes/Product.php:6015
295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM uag_feature_product pf
LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN uag_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 23366
ORDER BY f.position ASC
0.321 ms 4 Yes /classes/Product.php:6015
450
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23361) LIMIT 1
0.319 ms 1 /src/Adapter/EntityMapper.php:71
946
SELECT SQL_NO_CACHE gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "2024-05-08 14:25:18" OR date_from = "0000-00-00 00:00:00") AND (date_to >= "2024-05-08 14:25:18" OR date_to = "0000-00-00 00:00:00") AND gi.`id_shop` = 1 AND gi.`active` = 1  AND (gi.groups = ""  OR FIND_IN_SET(1, REPLACE(gi.groups, ";", ",")) > 0) AND (gi.manufacturers = "" OR FIND_IN_SET(59955, REPLACE(gi.manufacturers, ";", ",")) > 0) AND (gi.suppliers = "" ) ORDER BY position, priority
0.318 ms 1 Yes /modules/multipleprices/classes/MultiplepricesConfiguration.php:232
223
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8125 LIMIT 1
0.317 ms 1 /classes/Category.php:1378
58
SELECT SQL_NO_CACHE * FROM `uag_cart_rule` cr
LEFT JOIN `uag_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.316 ms 3 /classes/CartRule.php:423
378
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23351
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.316 ms 0 /classes/Product.php:1732
318
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23344) LIMIT 1
0.315 ms 1 /src/Adapter/EntityMapper.php:71
301
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23370)
0.315 ms 1 /classes/Product.php:3860
860
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23864) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.315 ms 1 /classes/stock/StockAvailable.php:453
208
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23357 AND id_shop=1 LIMIT 1
0.314 ms 1 /classes/Product.php:6870
871
SELECT SQL_NO_CACHE DISTINCT c.*
FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl ON (c.`id_category` = cl.`id_category` AND cl.`id_lang` = 1)
WHERE `level_depth` = 1
0.314 ms 1 /classes/Category.php:2242
973
SELECT SQL_NO_CACHE *
FROM `uag_cms` a
LEFT JOIN `uag_cms_lang` `b` ON a.`id_cms` = b.`id_cms` AND b.`id_lang` = 1
LEFT JOIN `uag_cms_shop` `c` ON a.`id_cms` = c.`id_cms` AND c.`id_shop` = 1
WHERE (a.`id_cms` = 3) AND (b.`id_shop` = 1) LIMIT 1
0.314 ms 1 /src/Adapter/EntityMapper.php:71
443
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23360 AND `id_shop` = 1
0.311 ms 1 /src/Adapter/EntityMapper.php:79
131
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23348
AND image_shop.`cover` = 1 LIMIT 1
0.310 ms 1 /classes/Product.php:3570
850
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23613) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.310 ms 1 /classes/stock/StockAvailable.php:453
198
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23356)
0.309 ms 1 /classes/Product.php:3860
408
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23356) LIMIT 1
0.309 ms 1 /src/Adapter/EntityMapper.php:71
416
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23357) LIMIT 1
0.308 ms 1 /src/Adapter/EntityMapper.php:71
22
SELECT SQL_NO_CACHE DISTINCT g.`id_group`, g.`reduction`, g.`price_display_method`, g.`show_prices`, gl.`name`
FROM `uag_group` g
LEFT JOIN `uag_group_lang` AS gl ON (g.`id_group` = gl.`id_group` AND gl.`id_lang` = 1)
ORDER BY g.`id_group` ASC
0.306 ms 6 Yes /classes/Group.php:111
1
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM uag_shop_group gs
LEFT JOIN uag_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN uag_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.305 ms 1 Yes /classes/shop/Shop.php:715
245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23361 AND id_shop=1 LIMIT 1
0.301 ms 1 /classes/Product.php:6870
387
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23352 LIMIT 1
0.299 ms 1 /classes/Product.php:1106
235
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23360)
0.297 ms 1 /classes/Product.php:3860
959
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23864)
GROUP BY a0.`id_supplier`
0.297 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
969
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 2) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.297 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
375
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.297 ms 1 /classes/stock/StockAvailable.php:806
186
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23355
AND image_shop.`cover` = 1 LIMIT 1
0.293 ms 1 /classes/Product.php:3570
8
SELECT SQL_NO_CACHE *
FROM `uag_lang` a
LEFT JOIN `uag_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.292 ms 1 /src/Adapter/EntityMapper.php:71
73
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedcookiebanner" LIMIT 1
0.292 ms 0 /classes/module/Module.php:2636
259
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23363
AND image_shop.`cover` = 1 LIMIT 1
0.292 ms 3 /classes/Product.php:3570
322
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23344 LIMIT 1
0.292 ms 1 /classes/Product.php:1106
898
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `uag_currency` c
LEFT JOIN uag_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.292 ms 1 /classes/Currency.php:1136
847
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23613)
0.292 ms 1 /classes/Product.php:3860
355
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23348 LIMIT 1
0.291 ms 1 /classes/Product.php:1106
496
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23366) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.291 ms 1 /classes/stock/StockAvailable.php:753
125
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23347)
0.290 ms 1 /classes/Product.php:3860
309
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 28034
AND `active` = 1 LIMIT 1
0.290 ms 1 /classes/Manufacturer.php:316
489
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.290 ms 1 /classes/stock/StockAvailable.php:806
442
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23360) LIMIT 1
0.289 ms 1 /src/Adapter/EntityMapper.php:71
10
SELECT SQL_NO_CACHE domain, domain_ssl
FROM uag_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.289 ms 1 /classes/shop/ShopUrl.php:182
51
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8183) AND (b.`id_shop` = 1) LIMIT 1
0.287 ms 1 /src/Adapter/EntityMapper.php:71
945
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23613)
GROUP BY a0.`id_supplier`
0.286 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
107
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23345)
0.285 ms 1 /classes/Product.php:3860
328
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23345) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
150
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.285 ms 1 /classes/Product.php:5655
889
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23864) LIMIT 1
0.285 ms 1 /src/Adapter/EntityMapper.php:71
907
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitcompare" LIMIT 1
0.285 ms 1 /classes/module/Module.php:2636
876
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23613) LIMIT 1
0.284 ms 1 /src/Adapter/EntityMapper.php:71
962
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_categorytree" LIMIT 1
0.284 ms 1 /classes/module/Module.php:2636
388
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23352
0.283 ms 1 /classes/Tag.php:244
854
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8153 LIMIT 1
0.283 ms 1 /classes/Product.php:5655
311
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 57929
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.282 ms 0 /classes/Product.php:1732
268
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23364
AND image_shop.`cover` = 1 LIMIT 1
0.281 ms 3 /classes/Product.php:3570
250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23362
AND image_shop.`cover` = 1 LIMIT 1
0.278 ms 3 /classes/Product.php:3570
484
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23365
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.278 ms 0 /classes/Product.php:1732
246
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23361 AND `id_group` = 1 LIMIT 1
0.274 ms 0 /classes/GroupReduction.php:156
149
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23350
AND image_shop.`cover` = 1 LIMIT 1
0.273 ms 1 /classes/Product.php:3570
492
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23366
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.273 ms 0 /classes/Product.php:1732
458
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23362) LIMIT 1
0.272 ms 1 /src/Adapter/EntityMapper.php:71
474
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23364) LIMIT 1
0.272 ms 1 /src/Adapter/EntityMapper.php:71
4
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM uag_shop s
LEFT JOIN uag_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.271 ms 1 /classes/shop/Shop.php:218
393
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23354 AND `id_shop` = 1
0.271 ms 1 /src/Adapter/EntityMapper.php:79
296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23370
AND image_shop.`cover` = 1 LIMIT 1
0.270 ms 1 /classes/Product.php:3570
134
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23348)
0.269 ms 1 /classes/Product.php:3860
6
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.269 ms 1 /src/Adapter/EntityMapper.php:71
33
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.267 ms 1 /src/Adapter/EntityMapper.php:71
934
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 23613
0.265 ms 10 /override/classes/Product.php:24
167
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23352
AND image_shop.`cover` = 1 LIMIT 1
0.265 ms 1 /classes/Product.php:3570
941
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.264 ms 0 /classes/tax/TaxRulesTaxManager.php:109
347
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23347 LIMIT 1
0.261 ms 1 /classes/Product.php:1106
363
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23349 LIMIT 1
0.261 ms 1 /classes/Product.php:1106
503
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23370 LIMIT 1
0.261 ms 1 /classes/Product.php:1106
104
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23345
AND image_shop.`cover` = 1 LIMIT 1
0.260 ms 1 /classes/Product.php:3570
143
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23349)
0.260 ms 1 /classes/Product.php:3860
204
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23357
AND image_shop.`cover` = 1 LIMIT 1
0.260 ms 1 /classes/Product.php:3570
364
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23349
0.260 ms 1 /classes/Tag.php:244
914
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.259 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
917
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_widgets" LIMIT 1
0.259 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
354
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23348
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.258 ms 0 /classes/Product.php:1732
389
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.258 ms 1 /classes/stock/StockAvailable.php:778
541
SELECT SQL_NO_CACHE * FROM uag_module_shop WHERE id_module = 109 AND id_shop = 1
0.258 ms 1 /modules/gremarketing/lib/moduleTools.php:403
870
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c WHERE c.id_category = 7878 LIMIT 1
0.258 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
953
SELECT SQL_NO_CACHE fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
FROM `uag_feature_product` fp
LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
WHERE `id_product` = 23864
0.258 ms 10 /override/classes/Product.php:24
954
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23864 LIMIT 1
0.257 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
511
SELECT SQL_NO_CACHE g.id_group as value, gl.name as label FROM `uag_group` g
LEFT JOIN `uag_group_lang` gl ON (g.id_group=gl.id_group AND gl.id_lang="1")
WHERE g.id_group !="1" AND g.id_group !="2"
0.256 ms 6 /modules/ybc_blog/ybc_blog_defines.php:3038
972
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 5) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.256 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
48
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8153) AND (b.`id_shop` = 1) LIMIT 1
0.254 ms 1 /src/Adapter/EntityMapper.php:71
195
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23356
AND image_shop.`cover` = 1 LIMIT 1
0.254 ms 1 /classes/Product.php:3570
46
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8126) AND (b.`id_shop` = 1) LIMIT 1
0.252 ms 1 /src/Adapter/EntityMapper.php:71
136
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23348 AND `id_group` = 1 LIMIT 1
0.252 ms 0 /classes/GroupReduction.php:156
955
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23864)
GROUP BY a0.`id_supplier`
0.252 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
345
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23347 AND `id_shop` = 1
0.251 ms 1 /src/Adapter/EntityMapper.php:79
26
SELECT SQL_NO_CACHE * FROM `uag_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.250 ms 1 /classes/module/Module.php:2018
263
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23363 AND id_shop=1 LIMIT 1
0.250 ms 1 /classes/Product.php:6870
337
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23346 AND `id_shop` = 1
0.250 ms 1 /src/Adapter/EntityMapper.php:79
346
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23347
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.249 ms 0 /classes/Product.php:1732
936
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23613 LIMIT 1
0.249 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
52
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8194) AND (b.`id_shop` = 1) LIMIT 1
0.249 ms 1 /src/Adapter/EntityMapper.php:71
79
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 57929 LIMIT 1
0.248 ms 1 /classes/SpecificPrice.php:435
466
SELECT SQL_NO_CACHE *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 23363) LIMIT 1
0.247 ms 1 /src/Adapter/EntityMapper.php:71
31
SELECT SQL_NO_CACHE value FROM `uag_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.246 ms 1 /classes/shop/Shop.php:1183
47
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8152) AND (b.`id_shop` = 1) LIMIT 1
0.246 ms 1 /src/Adapter/EntityMapper.php:71
937
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23613)
GROUP BY a0.`id_supplier`
0.246 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
411
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23356 LIMIT 1
0.245 ms 1 /classes/Product.php:1106
395
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23354 LIMIT 1
0.244 ms 1 /classes/Product.php:1106
405
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.243 ms 1 /classes/stock/StockAvailable.php:778
362
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23349
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.242 ms 0 /classes/Product.php:1732
928
SELECT SQL_NO_CACHE (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
FROM `uag_iqitreviews_products` pr
WHERE pr.`status` = 1  AND pr.`id_product` = 23613 LIMIT 1
0.242 ms 1 /modules/iqitreviews/src/IqitProductReview.php:116
170
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23352)
0.241 ms 1 /classes/Product.php:3860
320
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 40434
AND `active` = 1 LIMIT 1
0.241 ms 1 /classes/Manufacturer.php:316
241
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23361
AND image_shop.`cover` = 1 LIMIT 1
0.240 ms 3 /classes/Product.php:3570
886
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 3) LIMIT 1
0.240 ms 1 /src/Adapter/EntityMapper.php:71
5
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `uag_lang` l
LEFT JOIN `uag_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.240 ms 1 /classes/Language.php:1080
53
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8202) AND (b.`id_shop` = 1) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
361
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23349 AND `id_shop` = 1
0.239 ms 1 /src/Adapter/EntityMapper.php:79
385
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23352 AND `id_shop` = 1
0.239 ms 1 /src/Adapter/EntityMapper.php:79
44
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8086) AND (b.`id_shop` = 1) LIMIT 1
0.239 ms 1 /src/Adapter/EntityMapper.php:71
61
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.238 ms 0 /classes/module/Module.php:2636
478
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23364
0.238 ms 1 /classes/Tag.php:244
944
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23613 LIMIT 1
0.238 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
303
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23370 AND `id_group` = 1 LIMIT 1
0.237 ms 0 /classes/GroupReduction.php:156
333
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.236 ms 1 /classes/stock/StockAvailable.php:778
229
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23359) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.235 ms 1 /classes/stock/StockAvailable.php:453
233
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.235 ms 1 /classes/Product.php:5655
412
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23356
0.235 ms 1 /classes/Tag.php:244
54
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8212) AND (b.`id_shop` = 1) LIMIT 1
0.235 ms 1 /src/Adapter/EntityMapper.php:71
151
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23350 LIMIT 1
0.234 ms 1 /classes/SpecificPrice.php:435
916
DELETE FROM `uag_feedaty_cache` WHERE expiration < 1715171118
0.234 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:679
475
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23364 AND `id_shop` = 1
0.234 ms 1 /src/Adapter/EntityMapper.php:79
857
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23864)
0.234 ms 1 /classes/Product.php:3860
865
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 23613
0.234 ms 1 /classes/Product.php:2902
123
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.232 ms 1 /classes/Product.php:5655
140
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23349
AND image_shop.`cover` = 1 LIMIT 1
0.232 ms 1 /classes/Product.php:3570
379
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23351 LIMIT 1
0.231 ms 1 /classes/Product.php:1106
401
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23355 AND `id_shop` = 1
0.230 ms 1 /src/Adapter/EntityMapper.php:79
45
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8125) AND (b.`id_shop` = 1) LIMIT 1
0.229 ms 1 /src/Adapter/EntityMapper.php:71
232
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23360
AND image_shop.`cover` = 1 LIMIT 1
0.228 ms 3 /classes/Product.php:3570
158
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23351
AND image_shop.`cover` = 1 LIMIT 1
0.227 ms 1 /classes/Product.php:3570
494
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23366
0.227 ms 1 /classes/Tag.php:244
286
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23366
AND image_shop.`cover` = 1 LIMIT 1
0.226 ms 1 /classes/Product.php:3570
319
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23344 AND `id_shop` = 1
0.226 ms 1 /src/Adapter/EntityMapper.php:79
238
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23360) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.224 ms 1 /classes/stock/StockAvailable.php:453
371
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23350 LIMIT 1
0.224 ms 1 /classes/Product.php:1106
491
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23366 AND `id_shop` = 1
0.224 ms 1 /src/Adapter/EntityMapper.php:79
958
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23864 LIMIT 1
0.224 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
935
SELECT SQL_NO_CACHE `id_zone`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.223 ms 1 /classes/Country.php:224
38
SELECT SQL_NO_CACHE *
FROM `uag_group` a
LEFT JOIN `uag_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.222 ms 1 /src/Adapter/EntityMapper.php:71
896
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.222 ms 1 /classes/module/Module.php:2636
67
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 10) LIMIT 1
0.221 ms 1 /src/Adapter/EntityMapper.php:71
216
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23358)
0.221 ms 1 /classes/Product.php:3860
461
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23362 LIMIT 1
0.221 ms 1 /classes/Product.php:1106
545
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "payplug" LIMIT 1
0.221 ms 1 /classes/module/Module.php:2636
290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23366)
0.219 ms 1 /classes/Product.php:3860
332
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23345
0.219 ms 1 /classes/Tag.php:244
280
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23365)
0.218 ms 1 /classes/Product.php:3860
161
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23351)
0.218 ms 1 /classes/Product.php:3860
225
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23359 LIMIT 1
0.218 ms 1 /classes/SpecificPrice.php:435
451
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23361 AND `id_shop` = 1
0.218 ms 1 /src/Adapter/EntityMapper.php:79
843
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23613
AND image_shop.`cover` = 1 LIMIT 1
0.218 ms 1 /classes/Product.php:3570
349
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.217 ms 1 /classes/stock/StockAvailable.php:778
866
SELECT SQL_NO_CACHE state FROM uag_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.217 ms 1 /classes/FeatureFlag.php:105
910
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.217 ms 1 /classes/module/Module.php:2109
89
SELECT SQL_NO_CACHE tr.*
FROM `uag_tax_rule` tr
JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 10
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 234)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.216 ms 0 /classes/tax/TaxRulesTaxManager.php:109
224
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.215 ms 1 /classes/Product.php:5655
500
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23370 AND `id_shop` = 1
0.215 ms 1 /src/Adapter/EntityMapper.php:79
100
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23344 AND `id_group` = 1 LIMIT 1
0.215 ms 0 /classes/GroupReduction.php:156
302
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23370 AND id_shop=1 LIMIT 1
0.214 ms 1 /classes/Product.php:6870
35
SELECT SQL_NO_CACHE *
FROM `uag_currency` a
LEFT JOIN `uag_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23362 LIMIT 1
0.213 ms 1 /classes/SpecificPrice.php:435
551
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7878) LIMIT 1
0.213 ms 1 /src/Adapter/EntityMapper.php:71
971
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 4) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.213 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
380
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23351
0.212 ms 1 /classes/Tag.php:244
853
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23864
AND image_shop.`cover` = 1 LIMIT 1
0.212 ms 1 /classes/Product.php:3570
207
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23357)
0.211 ms 1 /classes/Product.php:3860
313
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=57929
0.211 ms 1 /classes/Tag.php:244
485
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23365 LIMIT 1
0.211 ms 1 /classes/Product.php:1106
95
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8086 LIMIT 1
0.210 ms 1 /classes/Category.php:1378
356
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23348
0.210 ms 1 /classes/Tag.php:244
396
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23354
0.210 ms 1 /classes/Tag.php:244
397
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.210 ms 1 /classes/stock/StockAvailable.php:778
418
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23357
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.210 ms 0 /classes/Product.php:1732
486
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23365
0.210 ms 1 /classes/Tag.php:244
493
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23366 LIMIT 1
0.209 ms 1 /classes/Product.php:1106
383
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.208 ms 1 /classes/stock/StockAvailable.php:806
970
SELECT SQL_NO_CACHE a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = 1)
WHERE (a.`id_lgcookieslaw_purpose` = 3) AND (a.`id_shop` = 1) AND (a.`active` = 1)
ORDER BY a.`name`
0.208 ms 21 Yes /modules/lgcookieslaw/classes/LGCookiesLawCookie.php:814
154
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23350 AND `id_group` = 1 LIMIT 1
0.208 ms 0 /classes/GroupReduction.php:156
417
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23357 AND `id_shop` = 1
0.208 ms 1 /src/Adapter/EntityMapper.php:79
869
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `uag_product_attribute`
WHERE `id_product` = 23864
0.207 ms 1 /classes/Product.php:2902
188
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23355 LIMIT 1
0.207 ms 1 /classes/SpecificPrice.php:435
200
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23356 AND `id_group` = 1 LIMIT 1
0.207 ms 0 /classes/GroupReduction.php:156
366
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.207 ms 1 /classes/stock/StockAvailable.php:753
339
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23346 LIMIT 1
0.206 ms 1 /classes/Product.php:1106
950
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23864)
GROUP BY a0.`id_supplier`
0.206 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
357
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.204 ms 1 /classes/stock/StockAvailable.php:778
277
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23365
AND image_shop.`cover` = 1 LIMIT 1
0.204 ms 4 /classes/Product.php:3570
300
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23370 LIMIT 1
0.203 ms 1 /classes/SpecificPrice.php:435
7
SELECT SQL_NO_CACHE *
FROM `uag_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.203 ms 1 /src/Adapter/EntityMapper.php:71
312
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 57929 LIMIT 1
0.202 ms 1 /classes/Product.php:1106
480
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.202 ms 1 /classes/stock/StockAvailable.php:753
323
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23344
0.201 ms 1 /classes/Tag.php:244
911
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_customersignin" LIMIT 1
0.201 ms 1 /classes/module/Module.php:2636
68
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 10
0.200 ms 1 /src/Adapter/EntityMapper.php:79
81
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 57929 AND id_shop=1 LIMIT 1
0.200 ms 1 /classes/Product.php:6870
899
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqithtmlandbanners" LIMIT 1
0.200 ms 1 /classes/module/Module.php:2636
110
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:453
365
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.199 ms 1 /classes/stock/StockAvailable.php:778
888
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23613 LIMIT 1
0.199 ms 1 /classes/Product.php:1106
908
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.199 ms 1 /classes/module/Module.php:2109
410
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23356
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.199 ms 0 /classes/Product.php:1732
872
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.198 ms 1 /src/Adapter/EntityMapper.php:71
370
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23350
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.198 ms 0 /classes/Product.php:1732
925
SELECT SQL_NO_CACHE c.id_elementor FROM uag_iqit_elementor_category c LEFT JOIN uag_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 7878 AND s.id_shop = 1 LIMIT 1
0.198 ms 1 /modules/iqitelementor/src/IqitElementorCategory.php:87
213
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23358
AND image_shop.`cover` = 1 LIMIT 1
0.197 ms 1 /classes/Product.php:3570
515
UPDATE `uag_ybc_blog_post` SET enabled=1,datetime_added="2024-05-08 14:25:17",datetime_modified="2024-05-08 14:25:17" WHERE datetime_active!="0000-00-00" AND datetime_active is not NULL AND enabled=2 AND datetime_active<=NOW()
0.197 ms 1 /modules/ybc_blog/classes/ybc_blog_post_class.php:622
227
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23359 AND id_shop=1 LIMIT 1
0.196 ms 1 /classes/Product.php:6870
446
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23360
0.196 ms 1 /classes/Tag.php:244
952
SELECT SQL_NO_CACHE `id_category` FROM `uag_category_product`
WHERE `id_product` = 23864
0.196 ms 3 /classes/Product.php:3423
192
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.195 ms 1 /classes/stock/StockAvailable.php:453
197
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23356 LIMIT 1
0.194 ms 1 /classes/SpecificPrice.php:435
931
SELECT SQL_NO_CACHE *
FROM `uag_product_supplier` a0
WHERE (a0.`id_product` = 23613)
GROUP BY a0.`id_supplier`
0.194 ms 1 Yes Yes /classes/PrestaShopCollection.php:383
137
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:453
374
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.193 ms 1 /classes/stock/StockAvailable.php:753
367
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.191 ms 1 /classes/stock/StockAvailable.php:806
437
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23359
0.191 ms 1 /classes/Tag.php:244
260
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.190 ms 1 /classes/Product.php:5655
348
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23347
0.190 ms 1 /classes/Tag.php:244
358
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.190 ms 1 /classes/stock/StockAvailable.php:753
433
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23359 AND `id_shop` = 1
0.190 ms 1 /src/Adapter/EntityMapper.php:79
413
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:778
419
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23357 LIMIT 1
0.189 ms 1 /classes/Product.php:1106
481
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.189 ms 1 /classes/stock/StockAvailable.php:806
930
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23613 LIMIT 1
0.189 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
369
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23350 AND `id_shop` = 1
0.188 ms 1 /src/Adapter/EntityMapper.php:79
939
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration` a
WHERE (a.`id_multipleprices_configuration` = 1) LIMIT 1
0.188 ms 1 /src/Adapter/EntityMapper.php:71
502
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23370
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.187 ms 0 /classes/Product.php:1732
510
SELECT SQL_NO_CACHE *
FROM `uag_gap_refund_partial` grf
WHERE (grf.shop_id=1) AND (grf.sent= "0") LIMIT 1
0.187 ms 1 /modules/ganalyticspro/models/orderPartialRefund.php:105
176
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `uag_image` i
INNER JOIN uag_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 23354
AND image_shop.`cover` = 1 LIMIT 1
0.186 ms 1 /classes/Product.php:3570
444
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23360
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.186 ms 0 /classes/Product.php:1732
329
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23345 AND `id_shop` = 1
0.186 ms 1 /src/Adapter/EntityMapper.php:79
391
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.186 ms 1 /classes/stock/StockAvailable.php:806
39
SELECT SQL_NO_CACHE *
FROM `uag_group_lang`
WHERE `id_group` = 1
0.185 ms 1 /src/Adapter/EntityMapper.php:79
114
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.185 ms 1 /classes/Product.php:5655
265
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.185 ms 1 /classes/stock/StockAvailable.php:453
279
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23365 LIMIT 1
0.185 ms 1 /classes/SpecificPrice.php:435
504
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23370
0.185 ms 1 /classes/Tag.php:244
177
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.184 ms 1 /classes/Product.php:5655
359
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:806
856
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23864 LIMIT 1
0.184 ms 1 /classes/SpecificPrice.php:435
164
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
183
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.184 ms 1 /classes/stock/StockAvailable.php:453
409
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23356 AND `id_shop` = 1
0.184 ms 1 /src/Adapter/EntityMapper.php:79
477
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23364 LIMIT 1
0.183 ms 1 /classes/Product.php:1106
976
SELECT SQL_NO_CACHE id_page_type
FROM uag_page_type
WHERE name = 'category' LIMIT 1
0.183 ms 1 /classes/Page.php:104
97
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23344 LIMIT 1
0.181 ms 1 /classes/SpecificPrice.php:435
918
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.181 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
940
SELECT SQL_NO_CACHE *
FROM `uag_multipleprices_configuration_lang`
WHERE `id_multipleprices_configuration` = 1
0.181 ms 1 /src/Adapter/EntityMapper.php:79
9
SELECT SQL_NO_CACHE id_shop
FROM `uag_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.181 ms 1 /classes/ObjectModel.php:1729
87
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 57929 AND `id_group` = 1 LIMIT 1
0.181 ms 0 /classes/GroupReduction.php:156
256
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
304
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23370) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.181 ms 1 /classes/stock/StockAvailable.php:453
890
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23864 AND `id_shop` = 1
0.181 ms 1 /src/Adapter/EntityMapper.php:79
278
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.180 ms 1 /classes/Product.php:5655
467
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23363 AND `id_shop` = 1
0.180 ms 1 /src/Adapter/EntityMapper.php:79
479
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.180 ms 1 /classes/stock/StockAvailable.php:778
897
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.180 ms 1 /classes/module/Module.php:2109
101
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:453
342
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:753
351
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:806
402
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23355
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.179 ms 0 /classes/Product.php:1732
429
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.179 ms 1 /classes/stock/StockAvailable.php:778
508
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8152 LIMIT 1
0.179 ms 0 /classes/Category.php:1378
155
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:453
251
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.178 ms 1 /classes/Product.php:5655
390
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23352) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.178 ms 1 /classes/stock/StockAvailable.php:753
331
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23345 LIMIT 1
0.177 ms 1 /classes/Product.php:1106
105
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.177 ms 1 /classes/Product.php:5655
180
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 23354)
0.176 ms 1 /classes/Product.php:3860
324
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:778
407
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.176 ms 1 /classes/stock/StockAvailable.php:806
469
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23363 LIMIT 1
0.176 ms 1 /classes/Product.php:1106
915
SELECT SQL_NO_CACHE * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_10215518_analytics" LIMIT 1
0.175 ms 1 /modules/feedaty/lib/FeedatyWebservice.php:704
78
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 0 LIMIT 1
0.174 ms 1 /classes/SpecificPrice.php:426
128
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:453
199
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23356 AND id_shop=1 LIMIT 1
0.174 ms 1 /classes/Product.php:6870
350
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23347) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.174 ms 1 /classes/stock/StockAvailable.php:753
920
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 82 AND `id_shop` = 1 LIMIT 1
0.174 ms 1 /classes/module/Module.php:2109
32
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.173 ms 1 /classes/Currency.php:893
146
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23349) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:453
153
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23350 AND id_shop=1 LIMIT 1
0.173 ms 1 /classes/Product.php:6870
315
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 57929) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.173 ms 1 /classes/stock/StockAvailable.php:753
855
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 69154
AND `active` = 1 LIMIT 1
0.173 ms 1 /classes/Manufacturer.php:316
912
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 8 AND `id_shop` = 1 LIMIT 1
0.173 ms 1 /classes/module/Module.php:2109
452
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23361
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.172 ms 0 /classes/Product.php:1732
341
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.172 ms 1 /classes/stock/StockAvailable.php:778
483
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23365 AND `id_shop` = 1
0.172 ms 1 /src/Adapter/EntityMapper.php:79
187
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.171 ms 1 /classes/Product.php:5655
210
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.170 ms 1 /classes/stock/StockAvailable.php:453
435
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23359
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.169 ms 0 /classes/Product.php:1732
476
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23364
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.169 ms 0 /classes/Product.php:1732
76
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8183 LIMIT 1
0.168 ms 1 /classes/Category.php:1378
372
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23350
0.168 ms 1 /classes/Tag.php:244
848
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23613 AND id_shop=1 LIMIT 1
0.168 ms 1 /classes/Product.php:6870
179
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23354 LIMIT 1
0.167 ms 1 /classes/SpecificPrice.php:435
498
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8126 LIMIT 1
0.167 ms 0 /classes/Category.php:1378
472
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.167 ms 1 /classes/stock/StockAvailable.php:753
901
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.167 ms 1 /classes/module/Module.php:2636
420
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23357
0.166 ms 1 /classes/Tag.php:244
445
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23360 LIMIT 1
0.165 ms 1 /classes/Product.php:1106
381
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.165 ms 1 /classes/stock/StockAvailable.php:778
34
SELECT SQL_NO_CACHE `id_lang` FROM `uag_lang`
WHERE `locale` = 'it-it'
OR `language_code` = 'it-it' LIMIT 1
0.164 ms 1 /classes/Language.php:883
40
SELECT SQL_NO_CACHE id_shop
FROM `uag_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.164 ms 1 /classes/ObjectModel.php:1729
66
SELECT SQL_NO_CACHE *
FROM `uag_state` a
WHERE (a.`id_state` = 234) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
160
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23351 LIMIT 1
0.164 ms 1 /classes/SpecificPrice.php:435
274
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23364) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.164 ms 1 /classes/stock/StockAvailable.php:453
317
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8183 LIMIT 1
0.164 ms 0 /classes/Category.php:1378
414
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.164 ms 1 /classes/stock/StockAvailable.php:753
62
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.164 ms 0 /classes/module/Module.php:2109
132
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.163 ms 1 /classes/Product.php:5655
316
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 57929) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:806
457
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:806
201
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23356) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.163 ms 1 /classes/stock/StockAvailable.php:453
884
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 7842) LIMIT 1
0.162 ms 1 /src/Adapter/EntityMapper.php:71
849
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23613 AND `id_group` = 1 LIMIT 1
0.162 ms 0 /classes/GroupReduction.php:156
228
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23359 AND `id_group` = 1 LIMIT 1
0.161 ms 0 /classes/GroupReduction.php:156
436
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23359 LIMIT 1
0.161 ms 1 /classes/Product.php:1106
431
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.161 ms 1 /classes/stock/StockAvailable.php:806
893
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7878 LIMIT 1
0.159 ms 1 /classes/Category.php:1585
904
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.159 ms 1 /classes/module/Module.php:2109
135
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23348 AND id_shop=1 LIMIT 1
0.158 ms 1 /classes/Product.php:6870
468
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23363
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.158 ms 0 /classes/Product.php:1732
544
SELECT SQL_NO_CACHE `name`
FROM `uag_hook`
WHERE `id_hook` = 1003 LIMIT 1
0.158 ms 1 /classes/Hook.php:244
555
SELECT SQL_NO_CACHE data FROM uag_layered_filter_block WHERE hash="6963814f1e7cd5dba3b93f1cd00e0d69" LIMIT 1
0.158 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
117
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23346 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6870
169
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23352 LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:435
215
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23358 LIMIT 1
0.157 ms 1 /classes/SpecificPrice.php:435
237
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23360 AND `id_group` = 1 LIMIT 1
0.157 ms 0 /classes/GroupReduction.php:156
254
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23362 AND id_shop=1 LIMIT 1
0.157 ms 1 /classes/Product.php:6870
297
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8152 LIMIT 1
0.157 ms 1 /classes/Category.php:1378
403
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23355 LIMIT 1
0.157 ms 1 /classes/Product.php:1106
428
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23358
0.157 ms 1 /classes/Tag.php:244
196
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.157 ms 1 /classes/Product.php:5655
438
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23359) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.157 ms 1 /classes/stock/StockAvailable.php:778
454
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23361
0.157 ms 1 /classes/Tag.php:244
546
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 130 AND `id_shop` = 1 LIMIT 1
0.157 ms 1 /classes/module/Module.php:2109
894
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.157 ms 1 /classes/Category.php:1591
124
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23347 LIMIT 1
0.156 ms 1 /classes/SpecificPrice.php:435
236
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23360 AND id_shop=1 LIMIT 1
0.156 ms 1 /classes/Product.php:6870
926
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitreviews" LIMIT 1
0.156 ms 1 /classes/module/Module.php:2636
36
SELECT SQL_NO_CACHE *
FROM `uag_currency_lang`
WHERE `id_currency` = 1
0.155 ms 1 /src/Adapter/EntityMapper.php:79
373
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23350) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.155 ms 1 /classes/stock/StockAvailable.php:778
536
SELECT SQL_NO_CACHE `id_country`
FROM `uag_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.155 ms 1 /classes/Country.php:194
264
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23363 AND `id_group` = 1 LIMIT 1
0.154 ms 0 /classes/GroupReduction.php:156
270
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23364 LIMIT 1
0.154 ms 1 /classes/SpecificPrice.php:435
487
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.154 ms 1 /classes/stock/StockAvailable.php:778
427
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23358 LIMIT 1
0.152 ms 1 /classes/Product.php:1106
209
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23357 AND `id_group` = 1 LIMIT 1
0.152 ms 0 /classes/GroupReduction.php:156
272
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23364 AND id_shop=1 LIMIT 1
0.152 ms 1 /classes/Product.php:6870
919
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.151 ms 1 /classes/module/Module.php:2636
96
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.151 ms 1 /classes/Product.php:5655
434
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 37777
AND `active` = 1 LIMIT 1
0.151 ms 1 /classes/Manufacturer.php:316
464
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.151 ms 1 /classes/stock/StockAvailable.php:753
539
SELECT SQL_NO_CACHE *
FROM `uag_country_lang`
WHERE `id_country` = 19
0.151 ms 1 /src/Adapter/EntityMapper.php:79
159
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.150 ms 1 /classes/Product.php:5655
283
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.150 ms 1 /classes/stock/StockAvailable.php:453
430
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.148 ms 1 /classes/stock/StockAvailable.php:753
462
SELECT SQL_NO_CACHE t.`id_lang`, t.`name`
FROM uag_tag t
LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
WHERE pt.`id_product`=23362
0.148 ms 1 /classes/Tag.php:244
880
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 8153) LIMIT 1
0.148 ms 1 /src/Adapter/EntityMapper.php:71
41
SELECT SQL_NO_CACHE `id_category`
FROM `uag_category_shop`
WHERE `id_category` = 7878
AND `id_shop` = 1 LIMIT 1
0.148 ms 1 /classes/Category.php:2450
460
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23362
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.148 ms 0 /classes/Product.php:1732
163
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23351 AND `id_group` = 1 LIMIT 1
0.147 ms 0 /classes/GroupReduction.php:156
310
SELECT SQL_NO_CACHE `name` FROM `uag_supplier` WHERE `id_supplier` = 0 LIMIT 1
0.147 ms 0 /classes/Supplier.php:243
877
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23613 AND `id_shop` = 1
0.147 ms 1 /src/Adapter/EntityMapper.php:79
287
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8126 LIMIT 1
0.146 ms 1 /classes/Category.php:1378
382
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23351) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.146 ms 1 /classes/stock/StockAvailable.php:753
534
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 10 LIMIT 1
0.146 ms 1 /classes/Country.php:252
327
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8086 LIMIT 1
0.145 ms 0 /classes/Category.php:1378
463
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.145 ms 1 /classes/stock/StockAvailable.php:778
902
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.145 ms 1 /classes/module/Module.php:2109
85
SELECT SQL_NO_CACHE *
FROM `uag_tax` a
WHERE (a.`id_tax` = 1) LIMIT 1
0.144 ms 1 /src/Adapter/EntityMapper.php:71
99
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23344 AND id_shop=1 LIMIT 1
0.144 ms 1 /classes/Product.php:6870
168
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.144 ms 1 /classes/Product.php:5655
942
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23613 AND `id_group` = 0 LIMIT 1
0.144 ms 0 /classes/GroupReduction.php:156
949
SELECT SQL_NO_CACHE id_manufacturer FROM `uag_product` WHERE id_product = 23864 LIMIT 1
0.144 ms 1 /modules/multipleprices/classes/MultiplepricesConfiguration.php:726
471
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.143 ms 1 /classes/stock/StockAvailable.php:778
873
SELECT SQL_NO_CACHE c.`nleft`, c.`nright`  FROM `uag_category` c
LEFT JOIN `uag_category_lang` cl
ON (c.`id_category` = cl.`id_category`
AND `id_lang` = 1 AND cl.id_shop = 1 ) WHERE c.`id_category` = 7878 LIMIT 1
0.143 ms 1 /classes/Category.php:1585
905
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.143 ms 1 /classes/module/Module.php:2636
425
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23358 AND `id_shop` = 1
0.143 ms 1 /src/Adapter/EntityMapper.php:79
882
SELECT SQL_NO_CACHE *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.143 ms 1 /src/Adapter/EntityMapper.php:71
127
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23347 AND `id_group` = 1 LIMIT 1
0.142 ms 0 /classes/GroupReduction.php:156
513
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 120 AND `id_shop` = 1 LIMIT 1
0.142 ms 1 /classes/module/Module.php:2109
881
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 8153 AND `id_shop` = 1
0.140 ms 1 /src/Adapter/EntityMapper.php:79
106
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23345 LIMIT 1
0.140 ms 1 /classes/SpecificPrice.php:435
133
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23348 LIMIT 1
0.140 ms 1 /classes/SpecificPrice.php:435
473
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.140 ms 1 /classes/stock/StockAvailable.php:806
512
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ybc_blog" LIMIT 1
0.140 ms 1 /classes/module/Module.php:2636
64
SELECT SQL_NO_CACHE format
FROM `uag_address_format`
WHERE `id_country` = 10 LIMIT 1
0.139 ms 1 /classes/AddressFormat.php:656
535
SELECT SQL_NO_CACHE c.id_currency
FROM `uag_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.139 ms 1 /classes/Currency.php:893
552
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7878 AND `id_shop` = 1
0.138 ms 1 /src/Adapter/EntityMapper.php:79
906
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 90 AND `id_shop` = 1 LIMIT 1
0.138 ms 1 /classes/module/Module.php:2109
923
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitelementor" LIMIT 1
0.138 ms 1 /classes/module/Module.php:2636
844
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 8153 LIMIT 1
0.137 ms 1 /classes/Category.php:1378
273
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23364 AND `id_group` = 1 LIMIT 1
0.136 ms 0 /classes/GroupReduction.php:156
335
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23345) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:806
465
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.135 ms 1 /classes/stock/StockAvailable.php:806
538
SELECT SQL_NO_CACHE *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.135 ms 1 /src/Adapter/EntityMapper.php:71
921
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.135 ms 1 /classes/module/Module.php:2636
488
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23365) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.134 ms 1 /classes/stock/StockAvailable.php:753
903
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.134 ms 1 /classes/module/Module.php:2636
459
SELECT SQL_NO_CACHE *
FROM `uag_product_lang`
WHERE `id_product` = 23362 AND `id_shop` = 1
0.133 ms 1 /src/Adapter/EntityMapper.php:79
523
CREATE TABLE IF NOT EXISTS `uag_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.132 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
892
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23864 LIMIT 1
0.132 ms 1 /classes/Product.php:1106
219
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:453
957
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23864 AND `id_group` = 0 LIMIT 1
0.131 ms 0 /classes/GroupReduction.php:156
423
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.131 ms 1 /classes/stock/StockAvailable.php:806
441
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8125 LIMIT 1
0.131 ms 0 /classes/Category.php:1378
518
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.131 ms 0 /classes/module/Module.php:2636
885
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 7842 AND `id_shop` = 1
0.131 ms 1 /src/Adapter/EntityMapper.php:79
77
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8183 LIMIT 1
0.130 ms 1 /classes/Product.php:5655
234
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23360 LIMIT 1
0.129 ms 1 /classes/SpecificPrice.php:435
439
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23359) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.129 ms 1 /classes/stock/StockAvailable.php:753
343
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23346) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.128 ms 1 /classes/stock/StockAvailable.php:806
205
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.127 ms 1 /classes/Product.php:5655
963
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 23 AND `id_shop` = 1 LIMIT 1
0.127 ms 1 /classes/module/Module.php:2109
288
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8126 LIMIT 1
0.126 ms 1 /classes/Product.php:5655
501
SELECT SQL_NO_CACHE `name`
FROM `uag_manufacturer`
WHERE `id_manufacturer` = 59955
AND `active` = 1 LIMIT 1
0.126 ms 1 /classes/Manufacturer.php:316
191
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23355 AND `id_group` = 1 LIMIT 1
0.126 ms 0 /classes/GroupReduction.php:156
206
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23357 LIMIT 1
0.126 ms 1 /classes/SpecificPrice.php:435
118
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23346 AND `id_group` = 1 LIMIT 1
0.125 ms 0 /classes/GroupReduction.php:156
108
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23345 AND id_shop=1 LIMIT 1
0.125 ms 1 /classes/Product.php:6870
421
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.124 ms 1 /classes/stock/StockAvailable.php:778
440
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23359) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.124 ms 1 /classes/stock/StockAvailable.php:806
887
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 3 AND `id_shop` = 1
0.124 ms 1 /src/Adapter/EntityMapper.php:79
255
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23362 AND `id_group` = 1 LIMIT 1
0.123 ms 0 /classes/GroupReduction.php:156
426
SELECT SQL_NO_CACHE COUNT(p.id_product)
FROM `uag_product` p
INNER JOIN uag_product_shop product_shop
ON (product_shop.id_product = p.id_product AND product_shop.id_shop = 1)
WHERE p.id_product = 23358
AND DATEDIFF("2024-05-08 00:00:00", product_shop.`date_add`) < 20 LIMIT 1
0.123 ms 0 /classes/Product.php:1732
453
SELECT SQL_NO_CACHE product_attribute_shop.id_product_attribute
FROM uag_product_attribute pa
INNER JOIN uag_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
WHERE pa.id_product = 23361 LIMIT 1
0.123 ms 1 /classes/Product.php:1106
883
SELECT SQL_NO_CACHE *
FROM `uag_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.123 ms 1 /src/Adapter/EntityMapper.php:79
269
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8125 LIMIT 1
0.122 ms 1 /classes/Product.php:5655
291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23366 AND id_shop=1 LIMIT 1
0.122 ms 1 /classes/Product.php:6870
281
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23365 AND id_shop=1 LIMIT 1
0.121 ms 1 /classes/Product.php:6870
325
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.120 ms 1 /classes/stock/StockAvailable.php:753
145
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23349 AND `id_group` = 1 LIMIT 1
0.119 ms 0 /classes/GroupReduction.php:156
447
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23360) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.119 ms 1 /classes/stock/StockAvailable.php:778
520
SELECT SQL_NO_CACHE * FROM `uag_image_type`
0.119 ms 8 /classes/ImageType.php:161
927
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 86 AND `id_shop` = 1 LIMIT 1
0.118 ms 1 /classes/module/Module.php:2109
214
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.117 ms 1 /classes/Product.php:5655
540
SELECT SQL_NO_CACHE id_module as id, active FROM uag_module WHERE name = "gmerchantcenterpro" AND active = 1
0.117 ms 1 /modules/gremarketing/lib/moduleTools.php:398
42
SELECT SQL_NO_CACHE ctg.`id_group`
FROM uag_category_group ctg
WHERE ctg.`id_category` = 7878 AND ctg.`id_group` = 1 LIMIT 1
0.116 ms 1 /classes/Category.php:1754
65
SELECT SQL_NO_CACHE `need_identification_number`
FROM `uag_country`
WHERE `id_country` = 10 LIMIT 1
0.116 ms 1 /classes/Country.php:405
141
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8086 LIMIT 1
0.116 ms 1 /classes/Product.php:5655
217
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23358 AND id_shop=1 LIMIT 1
0.116 ms 1 /classes/Product.php:6870
449
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23360) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.116 ms 1 /classes/stock/StockAvailable.php:806
530
SELECT SQL_NO_CACHE id_feed
FROM `uag_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.116 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:75
878
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `uag_category_lang` cl
WHERE `id_lang` = 0
AND cl.id_shop = 1 
AND cl.`id_category` = 8153 LIMIT 1
0.115 ms 0 /classes/Category.php:1378
282
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23365 AND `id_group` = 1 LIMIT 1
0.115 ms 0 /classes/GroupReduction.php:156
69
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM uag_required_field
0.114 ms 1 /classes/ObjectModel.php:1592
924
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 77 AND `id_shop` = 1 LIMIT 1
0.114 ms 1 /classes/module/Module.php:2109
891
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 23864) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.112 ms 1 /classes/Product.php:7720
399
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.111 ms 1 /classes/stock/StockAvailable.php:806
406
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.111 ms 1 /classes/stock/StockAvailable.php:753
879
SELECT SQL_NO_CACHE DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = 23613) AND (pl.id_lang = 1 AND pl.id_shop = 1 ) LIMIT 1
0.110 ms 1 /classes/Product.php:7720
144
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23349 AND id_shop=1 LIMIT 1
0.109 ms 1 /classes/Product.php:6870
293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = 23366) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.109 ms 1 /classes/stock/StockAvailable.php:453
537
SELECT SQL_NO_CACHE `name`
FROM `uag_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.109 ms 1 /classes/Country.php:252
859
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23864 AND `id_group` = 1 LIMIT 1
0.109 ms 0 /classes/GroupReduction.php:156
171
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23352 AND id_shop=1 LIMIT 1
0.108 ms 1 /classes/Product.php:6870
298
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8152 LIMIT 1
0.108 ms 1 /classes/Product.php:5655
162
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23351 AND id_shop=1 LIMIT 1
0.106 ms 1 /classes/Product.php:6870
326
SELECT SQL_NO_CACHE location
FROM `uag_stock_available`
WHERE (id_product = 23344) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:806
422
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.106 ms 1 /classes/stock/StockAvailable.php:753
922
SELECT SQL_NO_CACHE `id_module` FROM `uag_module_shop` WHERE `id_module` = 84 AND `id_shop` = 1 LIMIT 1
0.103 ms 1 /classes/module/Module.php:2109
37
SELECT SQL_NO_CACHE id_shop
FROM `uag_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.101 ms 1 /classes/ObjectModel.php:1729
943
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 0 LIMIT 1
0.100 ms 0 /classes/Group.php:154
289
SELECT SQL_NO_CACHE 1 FROM `uag_specific_price` WHERE id_product = 23366 LIMIT 1
0.098 ms 1 /classes/SpecificPrice.php:435
858
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23864 AND id_shop=1 LIMIT 1
0.098 ms 1 /classes/Product.php:6870
88
SELECT SQL_NO_CACHE `reduction`
FROM `uag_group`
WHERE `id_group` = 1 LIMIT 1
0.097 ms 1 /classes/Group.php:154
448
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23360) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.097 ms 1 /classes/stock/StockAvailable.php:753
455
SELECT SQL_NO_CACHE out_of_stock
FROM `uag_stock_available`
WHERE (id_product = 23361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.096 ms 1 /classes/stock/StockAvailable.php:778
398
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23354) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.093 ms 1 /classes/stock/StockAvailable.php:753
845
SELECT SQL_NO_CACHE name FROM uag_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 8153 LIMIT 1
0.092 ms 1 /classes/Product.php:5655
524
CREATE TABLE IF NOT EXISTS `uag_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.091 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
292
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23366 AND `id_group` = 1 LIMIT 1
0.087 ms 0 /classes/GroupReduction.php:156
542
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gmerchantcenter" LIMIT 1
0.086 ms 0 /classes/module/Module.php:2636
521
BEGIN
0.085 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:74
172
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23352 AND `id_group` = 1 LIMIT 1
0.084 ms 0 /classes/GroupReduction.php:156
874
SELECT SQL_NO_CACHE c.`nleft`, c.`nright` FROM `uag_category` c
WHERE c.`id_category` = 2 LIMIT 1
0.084 ms 1 /classes/Category.php:1591
181
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `uag_product_shop`
WHERE `id_product` = 23354 AND id_shop=1 LIMIT 1
0.083 ms 1 /classes/Product.php:6870
182
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23354 AND `id_group` = 1 LIMIT 1
0.083 ms 0 /classes/GroupReduction.php:156
218
SELECT SQL_NO_CACHE `reduction`
FROM `uag_product_group_reduction_cache`
WHERE `id_product` = 23358 AND `id_group` = 1 LIMIT 1
0.082 ms 0 /classes/GroupReduction.php:156
456
SELECT SQL_NO_CACHE depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = 23361) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.077 ms 1 /classes/stock/StockAvailable.php:753
526
CREATE TABLE IF NOT EXISTS `uag_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.075 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
525
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.074 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
519
SELECT SQL_NO_CACHE `id_module` FROM `uag_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.071 ms 0 /classes/module/Module.php:2636
527
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.071 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
528
CREATE TABLE IF NOT EXISTS `uag_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.070 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:72
529
COMMIT
0.044 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:100

Doubles

266 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM uag_product p LEFT JOIN uag_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN uag_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN uag_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN uag_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN uag_category_product cp ON (p.id_product = cp.id_product) INNER JOIN uag_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN uag_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN uag_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN uag_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=XX)) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN uag_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN uag_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value=XX)) GROUP BY fp.id_feature_value
28 queries
			SELECT `reduction`
			FROM `uag_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
27 queries
SELECT XX FROM `uag_specific_price` WHERE id_product = XX LIMIT XX
26 queries
SELECT image_shop.`id_image`
                    FROM `uag_image` i
                     INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
26 queries
SELECT name FROM uag_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
26 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `uag_product` p
INNER JOIN `uag_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `uag_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
26 queries
                            SELECT `id_tax_rules_group`
                            FROM `uag_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
26 queries
SELECT SUM(quantity)
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
26 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT cp.`quantity` as first_level_quantity, XX as pack_quantity
          FROM `uag_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, cp.`quantity` * p.`quantity` as pack_quantity
          FROM `uag_cart_product` cp JOIN `uag_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `uag_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            AND cp.`id_customization` = XX
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
26 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM uag_feature_product pf
                LEFT JOIN uag_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN uag_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN uag_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN uag_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
26 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) LIMIT XX
26 queries
SELECT *
							FROM `uag_product_lang`
							WHERE `id_product` = XX AND `id_shop` = XX
26 queries
SELECT product_attribute_shop.id_product_attribute
                FROM uag_product_attribute pa
                 INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
                WHERE pa.id_product = XX LIMIT XX
24 queries
SELECT COUNT(p.id_product)
            FROM `uag_product` p
             INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX)
            WHERE p.id_product = XX
            AND DATEDIFF("XX-XX-XX XX:XX:XX", product_shop.`date_add`) < XX LIMIT XX
24 queries
        SELECT t.`id_lang`, t.`name`
        FROM uag_tag t
        LEFT JOIN uag_product_tag pt ON (pt.id_tag = t.id_tag)
        WHERE pt.`id_product`=XX
24 queries
SELECT out_of_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT depends_on_stock
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries
SELECT location
FROM `uag_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
17 queries
SELECT `id_module` FROM `uag_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
13 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
12 queries
			SELECT cl.`link_rewrite`
			FROM `uag_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
11 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `uag_feature_value` v LEFT JOIN `uag_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `uag_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
6 queries
SELECT id_manufacturer FROM `uag_product` WHERE id_product = XX LIMIT XX
6 queries
SELECT *
FROM `uag_product_supplier` aXX
WHERE (aXX.`id_product` = XX)
GROUP BY aXX.`id_supplier`
6 queries
                 SELECT gi.* FROM `uag_multipleprices_configuration` gi  WHERE (date_from <= "XX-XX-XX XX:XX:XX" OR date_from = "XX-XX-XX XX:XX:XX") AND (date_to >= "XX-XX-XX XX:XX:XX" OR date_to = "XX-XX-XX XX:XX:XX") AND gi.`id_shop` = XX AND gi.`active` = XX  AND (gi.groups = ""  OR FIND_IN_SET(XX, REPLACE(gi.groups, ";", ",")) > XX) AND (gi.manufacturers = "" OR FIND_IN_SET(XX, REPLACE(gi.manufacturers, ";", ",")) > XX) AND (gi.suppliers = "" ) ORDER BY position, priority
5 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `uag_module` m
                LEFT JOIN `uag_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
5 queries
				SELECT `name`
				FROM `uag_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
5 queries
SELECT *
FROM `uag_category` a
LEFT JOIN `uag_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) LIMIT XX
5 queries
SELECT *
							FROM `uag_category_lang`
							WHERE `id_category` = XX AND `id_shop` = XX
5 queries
SELECT a.*, b.`cookie_purpose`, b.`expiry_time`, b.`script_code`
FROM `uag_lgcookieslaw_cookie` a
LEFT JOIN `uag_lgcookieslaw_cookie_lang` `b` ON (b.`id_lgcookieslaw_cookie` = a.`id_lgcookieslaw_cookie` AND b.`id_lang` = XX)
WHERE (a.`id_lgcookieslaw_purpose` = XX) AND (a.`id_shop` = XX) AND (a.`active` = XX)
ORDER BY a.`name`
4 queries
				SELECT tr.*
				FROM `uag_tax_rule` tr
				JOIN `uag_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
4 queries
SELECT *
FROM `uag_product` a
LEFT JOIN `uag_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `uag_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
2 queries
SELECT s.*, sl.`description`
FROM `uag_supplier` s
LEFT JOIN `uag_supplier_lang` `sl` ON s.`id_supplier` = sl.`id_supplier` AND sl.`id_lang` = XX
 INNER JOIN uag_supplier_shop supplier_shop
        ON (supplier_shop.id_supplier = s.id_supplier AND supplier_shop.id_shop = XX)
WHERE (s.`active` = XX)
GROUP BY s.id_supplier
ORDER BY  s.`name` ASC
2 queries
SELECT `id_lang` FROM `uag_lang`
                    WHERE `locale` = 'it-it'
                    OR `language_code` = 'it-it' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `uag_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
SELECT XX FROM `uag_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT *
FROM `uag_country` a
LEFT JOIN `uag_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
2 queries
SELECT *
							FROM `uag_country_lang`
							WHERE `id_country` = XX
2 queries
SELECT a.*, b.`name`, b.`description`
FROM `uag_lgcookieslaw_purpose` a
LEFT JOIN `uag_lgcookieslaw_purpose_lang` `b` ON (b.`id_lgcookieslaw_purpose` = a.`id_lgcookieslaw_purpose` AND b.`id_lang` = XX)
WHERE (a.`id_shop` = XX) AND (a.`active` = XX)
2 queries
SELECT p.*, product_shop.*, stock.out_of_stock, IFNULL(stock.quantity, XX) AS quantity, IFNULL(product_attribute_shop.id_product_attribute, XX) AS id_product_attribute,
					product_attribute_shop.minimal_quantity AS product_attribute_minimal_quantity, pl.`description`, pl.`description_short`, pl.`available_now`,
					pl.`available_later`, pl.`link_rewrite`, pl.`meta_description`, pl.`meta_keywords`, pl.`meta_title`, pl.`name`, image_shop.`id_image` id_image,
					il.`legend` as legend, m.`name` AS manufacturer_name, cl.`name` AS category_default,
					DATEDIFF(product_shop.`date_add`, DATE_SUB("XX-XX-XX XX:XX:XX",
					INTERVAL XX DAY)) > XX AS new, product_shop.price AS orderprice
				FROM `uag_category_product` cp
				LEFT JOIN `uag_product` p
					ON p.`id_product` = cp.`id_product`
				 INNER JOIN uag_product_shop product_shop
        ON (product_shop.id_product = p.id_product AND product_shop.id_shop = XX) LEFT JOIN `uag_product_attribute_shop` product_attribute_shop
				ON (p.`id_product` = product_attribute_shop.`id_product` AND product_attribute_shop.`default_on` = XX AND product_attribute_shop.id_shop=XX)
				 LEFT JOIN uag_stock_available stock
            ON (stock.id_product = `p`.id_product AND stock.id_product_attribute = XX AND stock.id_shop = XX  AND stock.id_shop_group = XX  )
				LEFT JOIN `uag_category_lang` cl
					ON (product_shop.`id_category_default` = cl.`id_category`
					AND cl.`id_lang` = XX AND cl.id_shop = XX )
				LEFT JOIN `uag_product_lang` pl
					ON (p.`id_product` = pl.`id_product`
					AND pl.`id_lang` = XX AND pl.id_shop = XX )
				LEFT JOIN `uag_image_shop` image_shop
					ON (image_shop.`id_product` = p.`id_product` AND image_shop.cover=XX AND image_shop.id_shop=XX)
				LEFT JOIN `uag_image_lang` il
					ON (image_shop.`id_image` = il.`id_image`
					AND il.`id_lang` = XX)
				LEFT JOIN `uag_manufacturer` m
					ON m.`id_manufacturer` = p.`id_manufacturer`
				WHERE product_shop.`id_shop` = XX
					AND cp.`id_category` = XX AND product_shop.`active` = XX AND product_shop.`visibility` IN ("both", "catalog") ORDER BY cp.`position` ASC
			LIMIT XX,XX
2 queries
			SELECT `reduction`
			FROM `uag_group`
			WHERE `id_group` = XX LIMIT XX
2 queries
							SELECT `name`
							FROM `uag_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
2 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `uag_image` i
             INNER JOIN uag_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `uag_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
2 queries
SELECT `id_product_attribute`
            FROM `uag_product_attribute`
            WHERE `id_product` = XX
2 queries
SELECT c.`nleft`, c.`nright`  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.`nleft`, c.`nright` FROM `uag_category` c
            WHERE c.`id_category` = XX LIMIT XX
2 queries
SELECT c.*, cl.*  FROM `uag_category` c
			LEFT JOIN `uag_category_lang` cl
				ON (c.`id_category` = cl.`id_category`
                    AND `id_lang` = XX AND cl.id_shop = XX ) WHERE c.`nleft` <= XX AND c.`nright` >= XX AND c.`nleft` >= XX AND c.`nright` <= XX ORDER BY `nleft` DESC
2 queries
SELECT DISTINCT pl.name as name
FROM `uag_product_lang` pl
WHERE (pl.id_product = XX) AND (pl.id_lang = XX AND pl.id_shop = XX ) LIMIT XX
2 queries
DELETE FROM `uag_feedaty_cache` WHERE expiration < XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_widgets" LIMIT XX
2 queries
SELECT * FROM `uag_feedaty_cache` WHERE id_key = "feedaty_data_XX_analytics" LIMIT XX
2 queries
				SELECT (SUM(pr.`rating`) / COUNT(pr.`rating`)) AS avarageRating, COUNT(pr.`rating`) as reviewsNb
				FROM `uag_iqitreviews_products` pr
				WHERE pr.`status` = XX  AND pr.`id_product` = XX LIMIT XX
2 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `uag_product_attribute` pa
             INNER JOIN uag_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `uag_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `uag_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `uag_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `uag_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
2 queries
                SELECT `id_category` FROM `uag_category_product`
                WHERE `id_product` = XX
2 queries
                SELECT fp.id_feature, fp.id_product, fp.id_feature_value, custom, fv.chiave_gestionale
                FROM `uag_feature_product` fp
                LEFT JOIN `uag_feature_value` fv ON (fp.id_feature_value = fv.id_feature_value)
                WHERE `id_product` = XX

Tables stress

841 feature_product
391 product
385 product_shop
379 stock_available
307 product_attribute
305 category
281 category_product
279 category_group
279 product_attribute_combination
274 product_sale
67 category_lang
56 product_attribute_shop
53 cart_product
37 feature_value_lang
35 product_lang
31 module
30 image_shop
28 feature
28 feature_shop
28 feature_lang
28 image
28 product_group_reduction_cache
27 specific_price
26 pack
24 module_shop
24 tag
24 product_tag
23 category_shop
13 feature_value
11 layered_indexable_feature_value_lang_value
8 manufacturer
7 country
7 hook
7 multipleprices_configuration
6 currency
6 feedaty_cache
6 product_supplier
5 lang
5 country_lang
5 group
5 lgcookieslaw_cookie
5 lgcookieslaw_cookie_lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 cart_rule
4 image_lang
4 tax_rule
4 tax_rules_group
3 country_shop
3 hook_alias
3 supplier
3 group_lang
3 group_shop
3 gmcp_feeds
2 shop_group
2 configuration
2 hook_module
2 supplier_lang
2 supplier_shop
2 currency_lang
2 cart_rule_lang
2 image_type
2 lgcookieslaw_purpose
2 lgcookieslaw_purpose_lang
2 iqit_elementor_category
2 iqitreviews_products
2 attribute
2 attribute_lang
2 attribute_group
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 address_format
1 state
1 required_field
1 revslider_sliders
1 tax
1 tax_lang
1 gap_refund
1 gap_refund_partial
1 ets_abancart_campaign
1 ets_abancart_campaign_country
1 ets_abancart_campaign_with_lang
1 ets_abancart_campaign_group
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 manufacturer_shop
1 manufacturer_lang
1 layered_price_index
1 feature_flag
1 iqit_elementor_category_shop
1 multipleprices_configuration_lang
1 ybc_blog_post
1 ybc_blog_post_shop
1 ybc_blog_post_lang
1 ybc_blog_post_category
1 ybc_blog_post_related_categories
1 customer
1 employee
1 ybc_blog_employee
1 ybc_blog_comment
1 cms
1 cms_lang
1 cms_shop
1 connections
1 page_type
1 page

ObjectModel instances

Name Instances Source
Category 69 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 7878]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8086]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8125]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8126]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8152]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8153]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8160]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8167]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8183]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8194]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8202]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 8212]
/classes/Meta.php:380 (__construct) [id: 7878]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ganalyticspro/lib/gtag/categoryTag.php:33 (__construct) [id: 7878]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7878]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8183]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8086]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8125]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8126]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 8152]
/modules/ganalyticspro/lib/moduleTools.php:158 (__construct) [id: 7878]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:64 (__construct) [id: 7878]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:171 (__construct) [id: 7878]
/modules/connettore/connettore.php:490 (__construct) [id: 7878]
/modules/ps_facetedsearch/src/Product/Search.php:364 (__construct) [id: 7878]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8153]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1338 (__construct) [id: 2]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php:99 (__construct) [id: 8153]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 3]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7842]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1287 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1277 (__construct) [id: 7878]
/modules/cdc_googletagmanager/cdc_googletagmanager.php:1305 (getParentsCategories) [id: 2]
/modules/ps_categorytree/ps_categorytree.php:338 (__construct) [id: 7878]
Product 40 /classes/Link.php:113 (__construct) [id: 23354]
/classes/Link.php:113 (__construct) [id: 23370]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 57929]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23344]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23345]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23346]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23347]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23348]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23349]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23350]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23351]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23352]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23354]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23355]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23356]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23357]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23358]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23359]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23360]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23361]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23362]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23363]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23364]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23365]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23366]
/modules/ganalyticspro/lib/moduleTools.php:646 (__construct) [id: 23370]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 23613]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 23864]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23613]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23613]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23864]
/modules/cdc_googletagmanager/services/Gtm_Product.php:154 (__construct) [id: 23864]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 23613]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23613]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23613]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23613]
/modules/artproduttori/artproduttori.php:164 (__construct) [id: 23864]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23864]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23864]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:598 (__construct) [id: 23864]
Address 38 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5958 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/classes/Product.php:741 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/multipleprices/classes/MultiplepricesConfiguration.php:909 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/AddressAdapter.php:38 (__construct) [id: ]
Cart 10 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/CartAdapter.php:38 (__construct) [id: ]
Configuration 8 /modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/ConfigurationAdapter.php:38 (__construct) [id: ]
Carrier 8 /modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
/modules/payplug/src/application/adapter/CarrierAdapter.php:45 (__construct) [id: ]
OrderState 8 /modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
/modules/payplug/src/application/adapter/OrderStateAdapter.php:38 (__construct) [id: ]
Language 6 /config/config.inc.php:211 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/ganalyticspro/lib/gtag/categoryTag.php:52 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:201 (__construct) [id: 1]
/modules/gremarketing/lib/tags/dynamicCategoryTag.php:139 (__construct) [id: 1]
Country 6 /config/config.inc.php:146 (__construct) [id: 10]
/classes/controller/FrontController.php:354 (__construct) [id: 10]
/classes/AddressFormat.php:404 (__construct) [id: 10]
/classes/controller/FrontController.php:1767 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 10]
/modules/gmerchantcenterpro/lib/moduleTools.php:206 (__construct) [id: 19]
Currency 3 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:695 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:211 (__construct) [id: 1]
Tax 2 /classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
/classes/tax/TaxRulesTaxManager.php:116 (__construct) [id: 1]
Group 2 /classes/Cart.php:249 (getCurrent) [id: 1]
/modules/ets_abandonedcart/classes/EtsAbancartCampaign.php:370 (__construct) [id: 1]
MultiplepricesConfiguration 2 /modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
/modules/multipleprices/multipleprices.php:285 (getPriceByProduct) [id: 1]
State 2 /classes/AddressFormat.php:404 (__construct) [id: 234]
/classes/controller/FrontController.php:1766 (__construct) [id: 234]
Shop 1 /config/config.inc.php:117 (initialize) [id: 1]
Guest 1 /modules/statsdata/statsdata.php:82 (setNewGuest) [id: ]
Connection 1 /modules/statsdata/statsdata.php:118 (setPageConnection) [id: ]
CMS 1 /classes/Link.php:555 (__construct) [id: 3]
AddressFormat 1 /classes/controller/FrontController.php:1761 (generateAddress) [id: ]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]
Risk 1 /classes/controller/FrontController.php:1694 (__construct) [id: ]
Gender 1 /classes/controller/FrontController.php:1691 (__construct) [id: 0]
Customer 1 /config/config.inc.php:264 (__construct) [id: ]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
ConnectionsSource 1 /modules/statsdata/statsdata.php:119 (logHttpReferer) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
12 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
13 /vendor/symfony/polyfill-intl-idn/bootstrap.php
14 /vendor/symfony/polyfill-mbstring/bootstrap.php
15 /vendor/symfony/polyfill-mbstring/bootstrap80.php
16 /vendor/symfony/polyfill-php80/bootstrap.php
17 /vendor/symfony/polyfill-ctype/bootstrap.php
18 /vendor/symfony/polyfill-ctype/bootstrap80.php
19 /vendor/symfony/deprecation-contracts/function.php
20 /vendor/guzzlehttp/promises/src/functions_include.php
21 /vendor/guzzlehttp/promises/src/functions.php
22 /vendor/symfony/polyfill-iconv/bootstrap.php
23 /vendor/ralouphie/getallheaders/src/getallheaders.php
24 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
25 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
26 /vendor/guzzlehttp/guzzle/src/functions_include.php
27 /vendor/guzzlehttp/guzzle/src/functions.php
28 /vendor/symfony/polyfill-php81/bootstrap.php
29 /vendor/symfony/polyfill-php73/bootstrap.php
30 /vendor/symfony/polyfill-intl-icu/bootstrap.php
31 /vendor/lcobucci/jwt/compat/class-aliases.php
32 /vendor/lcobucci/jwt/src/Token.php
33 /vendor/lcobucci/jwt/src/Signature.php
34 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
35 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
36 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
37 /vendor/jakeasmith/http_build_url/src/http_build_url.php
38 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
39 /vendor/ircmaxell/password-compat/lib/password.php
40 /vendor/api-platform/core/src/deprecation.php
41 /vendor/api-platform/core/src/Api/FilterInterface.php
42 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
43 /vendor/api-platform/core/src/deprecated_interfaces.php
44 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
45 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
46 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
55 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
56 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
57 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
58 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
59 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
60 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
61 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
62 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
63 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
64 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
65 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
66 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
67 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
68 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
69 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
70 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
71 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
72 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
73 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
74 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
75 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
76 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
77 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
78 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
79 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
85 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
86 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
87 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
90 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
93 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
94 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
96 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
97 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
98 /vendor/psr/container/src/ContainerInterface.php
99 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
100 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /override/classes/Configuration.php
134 /classes/Configuration.php
135 /classes/Validate.php
136 /classes/cache/Cache.php
137 /src/Adapter/EntityMapper.php
138 /classes/db/DbQuery.php
139 /src/Core/Addon/Theme/ThemeManagerBuilder.php
140 /vendor/psr/log/Psr/Log/NullLogger.php
141 /vendor/psr/log/Psr/Log/AbstractLogger.php
142 /vendor/psr/log/Psr/Log/LoggerInterface.php
143 /src/Adapter/Configuration.php
144 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
145 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
146 /src/Core/ConfigurationInterface.php
147 /src/Core/Addon/Theme/ThemeRepository.php
148 /src/Core/Addon/AddonRepositoryInterface.php
149 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
150 /src/Core/Addon/Theme/Theme.php
151 /src/Core/Addon/AddonInterface.php
152 /src/Core/Util/File/YamlParser.php
153 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
154 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
155 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
156 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceChecker.php
157 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerInterface.php
158 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/FileResource.php
159 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/SelfCheckingResourceInterface.php
160 /vendor/symfony/symfony/src/Symfony/Component/Config/Resource/ResourceInterface.php
161 /var/cache/prod/yaml/84a464d0176e3f6031f8e8ec956aa9cf.php
162 /src/Core/Util/ArrayFinder.php
163 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
164 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
165 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
166 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
167 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
168 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
169 /config/defines_uri.inc.php
170 /classes/Language.php
171 /src/Core/Language/LanguageInterface.php
172 /classes/Country.php
173 /classes/PrestaShopCollection.php
174 /classes/shop/ShopGroup.php
175 /classes/Cookie.php
176 /classes/PhpEncryption.php
177 /classes/PhpEncryptionEngine.php
178 /vendor/defuse/php-encryption/src/Key.php
179 /vendor/defuse/php-encryption/src/Encoding.php
180 /vendor/defuse/php-encryption/src/Core.php
181 /src/Core/Session/SessionHandler.php
182 /src/Core/Session/SessionHandlerInterface.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
197 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
198 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
199 /config/smarty.config.inc.php
200 /vendor/smarty/smarty/libs/Smarty.class.php
201 /vendor/smarty/smarty/libs/functions.php
202 /vendor/smarty/smarty/libs/Autoloader.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
210 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
211 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
212 /config/smartyfront.config.inc.php
213 /classes/Smarty/SmartyResourceModule.php
214 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
215 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
216 /classes/Smarty/SmartyResourceParent.php
217 /classes/Smarty/SmartyLazyRegister.php
218 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
219 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
220 /classes/Customer.php
221 /classes/Group.php
222 /override/classes/Link.php
223 /classes/Link.php
224 /classes/shop/ShopUrl.php
225 /override/classes/Dispatcher.php
226 /classes/Dispatcher.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
232 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
233 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
234 /src/Adapter/SymfonyContainer.php
235 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
236 /config/db_slave_server.inc.php
237 /modules/doofinder/doofinder.php
238 /modules/doofinder/lib/dfTools.class.php
239 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
240 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
241 /classes/Translate.php
242 /modules/doofinder/translations/it.php
243 /src/PrestaShopBundle/Translation/TranslatorComponent.php
244 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
245 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
246 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
247 /vendor/symfony/contracts/Translation/TranslatorInterface.php
248 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
249 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
250 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
251 /src/PrestaShopBundle/Translation/TranslatorInterface.php
252 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
253 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
254 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
255 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
256 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
257 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
258 /vendor/symfony/contracts/Translation/TranslatorTrait.php
259 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
260 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
261 /var/cache/prod/translations/catalogue.it-IT.NXhscRe.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
263 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
264 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
265 /modules/ybc_blog/ybc_blog.php
266 /modules/ybc_blog/classes/ybc_blog_category_class.php
267 /modules/ybc_blog/classes/ybc_blog_post_class.php
268 /modules/ybc_blog/classes/ybc_blog_paggination_class.php
269 /modules/ybc_blog/classes/ybc_blog_comment_class.php
270 /modules/ybc_blog/classes/ybc_blog_reply_class.php
271 /modules/ybc_blog/classes/ybc_blog_polls_class.php
272 /modules/ybc_blog/classes/ybc_blog_slide_class.php
273 /modules/ybc_blog/classes/ybc_blog_gallery_class.php
274 /modules/ybc_blog/classes/ybc_blog_link_class.php
275 /modules/ybc_blog/classes/ybc_blog_employee_class.php
276 /modules/ybc_blog/classes/ybc_blog_email_template_class.php
277 /modules/ybc_blog/classes/ImportExport.php
278 /modules/ybc_blog/classes/ybc_browser.php
279 /modules/ybc_blog/ybc_blog_defines.php
280 /modules/ybc_blog/classes/ybc_chatgpt.php
281 /modules/ybc_blog/classes/ybc_chatgpt_message.php
282 /modules/ybc_blog/src/FormType/DescriptionType.php
283 /src/PrestaShopBundle/Form/Admin/Sell/Product/Description/DescriptionType.php
284 /src/PrestaShopBundle/Form/Admin/Type/TranslatorAwareType.php
285 /src/PrestaShopBundle/Form/Admin/Type/CommonAbstractType.php
286 /vendor/symfony/symfony/src/Symfony/Component/Form/AbstractType.php
287 /vendor/symfony/symfony/src/Symfony/Component/Form/FormTypeInterface.php
288 /modules/ybc_blog/translations/it.php
289 /modules/simpleimportproduct/simpleimportproduct.php
290 /modules/simpleimportproduct/classes/mpmTools.php
291 /modules/simpleimportproduct/translations/it.php
292 /classes/Supplier.php
293 /override/classes/Feature.php
294 /classes/Feature.php
295 /modules/ets_abandonedcart/ets_abandonedcart.php
296 /modules/ets_abandonedcart/classes/EtsAbancartCore.php
297 /modules/ets_abandonedcart/classes/EtsAbancartCache.php
298 /modules/ets_abandonedcart/classes/EtsAbancartValidate.php
299 /modules/ets_abandonedcart/classes/EtsAbancartTools.php
300 /modules/ets_abandonedcart/classes/EtsAbancartMail.php
301 /classes/Mail.php
302 /modules/ets_abandonedcart/classes/EtsAbancartIndex.php
303 /modules/ets_abandonedcart/classes/EtsAbancartIndexCustomer.php
304 /modules/ets_abandonedcart/classes/EtsAbancartCampaign.php
305 /modules/ets_abandonedcart/classes/EtsAbancartReminder.php
306 /modules/ets_abandonedcart/classes/EtsAbancartEmailTemplate.php
307 /modules/ets_abandonedcart/classes/EtsAbancartTracking.php
308 /modules/ets_abandonedcart/classes/EtsAbancartDisplayTracking.php
309 /modules/ets_abandonedcart/classes/EtsAbancartReminderForm.php
310 /modules/ets_abandonedcart/classes/EtsAbancartQueue.php
311 /modules/ets_abandonedcart/classes/EtsAbancartShoppingCart.php
312 /modules/ets_abandonedcart/classes/EtsAbancartUnsubscribers.php
313 /modules/ets_abandonedcart/classes/EtsAbancartDefines.php
314 /modules/ets_abandonedcart/classes/EtsAbancartForm.php
315 /modules/ets_abandonedcart/classes/EtsAbancartFormSubmit.php
316 /modules/ets_abandonedcart/classes/EtsAbancartField.php
317 /modules/ets_abandonedcart/classes/EtsAbancartFieldValue.php
318 /modules/ets_abandonedcart/translations/it.php
319 /controllers/front/listing/CategoryController.php
320 /classes/controller/ProductListingFrontController.php
321 /classes/controller/ProductPresentingFrontController.php
322 /classes/controller/FrontController.php
323 /src/Adapter/Presenter/Object/ObjectPresenter.php
324 /src/Adapter/Presenter/PresenterInterface.php
325 /src/Adapter/Presenter/Cart/CartPresenter.php
326 /src/Adapter/Product/PriceFormatter.php
327 /src/Adapter/Image/ImageRetriever.php
328 /classes/tax/TaxConfiguration.php
329 /classes/Smarty/TemplateFinder.php
330 /classes/assets/StylesheetManager.php
331 /classes/assets/AbstractAssetManager.php
332 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
333 /classes/assets/JavascriptManager.php
334 /classes/assets/CccReducer.php
335 /modules/iqitthemeeditor/iqitthemeeditor.php
336 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
337 /modules/iqitthemeeditor/translations/it.php
338 /override/classes/Category.php
339 /classes/Category.php
340 /classes/webservice/WebserviceRequest.php
341 /src/Adapter/ContainerBuilder.php
342 /src/Adapter/Environment.php
343 /src/Core/EnvironmentInterface.php
344 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
345 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
346 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
347 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
348 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
349 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
350 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
351 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
352 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
353 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
354 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
355 /vendor/symfony/contracts/Service/ResetInterface.php
356 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
357 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
358 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
359 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
360 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
361 /vendor/symfony/contracts/Cache/ItemInterface.php
362 /vendor/psr/cache/src/CacheItemInterface.php
363 /vendor/psr/cache/src/CacheItemPoolInterface.php
364 /vendor/symfony/contracts/Cache/CacheInterface.php
365 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
367 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
369 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
370 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
371 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
372 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
373 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
374 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
389 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
390 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
391 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
392 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
393 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
396 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
397 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
398 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
399 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
400 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
401 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
402 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
403 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
404 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
405 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
406 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
407 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
408 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
409 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
410 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
411 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
412 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
413 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
414 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
415 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
416 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
417 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
418 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
419 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
420 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
421 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
422 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
423 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
424 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
425 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
426 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
427 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
428 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
429 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
430 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
431 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
432 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
433 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
434 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
435 /var/cache/prod/FrontContainer.php
436 /src/Adapter/Container/LegacyContainer.php
437 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
438 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
439 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
440 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
441 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
442 /vendor/psr/container/src/ContainerExceptionInterface.php
443 /vendor/psr/container/src/NotFoundExceptionInterface.php
444 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
445 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
446 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
447 /src/Adapter/Container/LegacyContainerInterface.php
448 /modules/ps_shoppingcart/vendor/autoload.php
449 /modules/ps_shoppingcart/vendor/composer/autoload_real.php
450 /modules/ps_shoppingcart/vendor/composer/platform_check.php
451 /modules/ps_shoppingcart/vendor/composer/autoload_static.php
452 /modules/ps_emailsubscription/vendor/autoload.php
453 /modules/ps_emailsubscription/vendor/composer/autoload_real.php
454 /modules/ps_emailsubscription/vendor/composer/platform_check.php
455 /modules/ps_emailsubscription/vendor/composer/autoload_static.php
456 /modules/productcomments/vendor/autoload.php
457 /modules/productcomments/vendor/composer/autoload_real.php
458 /modules/productcomments/vendor/composer/platform_check.php
459 /modules/productcomments/vendor/composer/autoload_static.php
460 /modules/ps_facetedsearch/vendor/autoload.php
461 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
462 /modules/ps_facetedsearch/vendor/composer/platform_check.php
463 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
464 /modules/contactform/vendor/autoload.php
465 /modules/contactform/vendor/composer/autoload_real.php
466 /modules/contactform/vendor/composer/platform_check.php
467 /modules/contactform/vendor/composer/autoload_static.php
468 /modules/ps_emailalerts/vendor/autoload.php
469 /modules/ps_emailalerts/vendor/composer/autoload_real.php
470 /modules/ps_emailalerts/vendor/composer/platform_check.php
471 /modules/ps_emailalerts/vendor/composer/autoload_static.php
472 /modules/ps_checkpayment/vendor/autoload.php
473 /modules/ps_checkpayment/vendor/composer/autoload_real.php
474 /modules/ps_checkpayment/vendor/composer/platform_check.php
475 /modules/ps_checkpayment/vendor/composer/autoload_static.php
476 /modules/ps_wirepayment/vendor/autoload.php
477 /modules/ps_wirepayment/vendor/composer/autoload_real.php
478 /modules/ps_wirepayment/vendor/composer/platform_check.php
479 /modules/ps_wirepayment/vendor/composer/autoload_static.php
480 /modules/statscheckup/vendor/autoload.php
481 /modules/statscheckup/vendor/composer/autoload_real.php
482 /modules/statscheckup/vendor/composer/platform_check.php
483 /modules/statscheckup/vendor/composer/autoload_static.php
484 /modules/statscatalog/vendor/autoload.php
485 /modules/statscatalog/vendor/composer/autoload_real.php
486 /modules/statscatalog/vendor/composer/platform_check.php
487 /modules/statscatalog/vendor/composer/autoload_static.php
488 /modules/dashactivity/vendor/autoload.php
489 /modules/dashactivity/vendor/composer/autoload_real.php
490 /modules/dashactivity/vendor/composer/platform_check.php
491 /modules/dashactivity/vendor/composer/autoload_static.php
492 /modules/dashproducts/vendor/autoload.php
493 /modules/dashproducts/vendor/composer/autoload_real.php
494 /modules/dashproducts/vendor/composer/platform_check.php
495 /modules/dashproducts/vendor/composer/autoload_static.php
496 /modules/dashtrends/vendor/autoload.php
497 /modules/dashtrends/vendor/composer/autoload_real.php
498 /modules/dashtrends/vendor/composer/platform_check.php
499 /modules/dashtrends/vendor/composer/autoload_static.php
500 /modules/ps_distributionapiclient/vendor/autoload.php
501 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
502 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
503 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
504 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
505 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
506 /modules/pagesnotfound/vendor/autoload.php
507 /modules/pagesnotfound/vendor/composer/autoload_real.php
508 /modules/pagesnotfound/vendor/composer/platform_check.php
509 /modules/pagesnotfound/vendor/composer/autoload_static.php
510 /modules/statsproduct/vendor/autoload.php
511 /modules/statsproduct/vendor/composer/autoload_real.php
512 /modules/statsproduct/vendor/composer/platform_check.php
513 /modules/statsproduct/vendor/composer/autoload_static.php
514 /modules/ps_themecusto/vendor/autoload.php
515 /modules/ps_themecusto/vendor/composer/autoload_real.php
516 /modules/ps_themecusto/vendor/composer/platform_check.php
517 /modules/ps_themecusto/vendor/composer/autoload_static.php
518 /modules/ps_checkout/vendor/autoload.php
519 /modules/ps_checkout/vendor/composer/autoload_real.php
520 /modules/ps_checkout/vendor/composer/platform_check.php
521 /modules/ps_checkout/vendor/composer/autoload_static.php
522 /modules/ps_checkout/vendor/clue/stream-filter/src/functions_include.php
523 /modules/ps_checkout/vendor/clue/stream-filter/src/functions.php
524 /modules/ps_checkout/vendor/php-http/message/src/filters.php
525 /modules/ps_checkout/vendor/ramsey/uuid/src/functions.php
526 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment.php
527 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Client.php
528 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
529 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
530 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
531 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
532 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
533 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
534 /modules/ps_checkout/vendor/segmentio/analytics-php/lib/Segment/Version.php
535 /modules/ps_accounts/vendor/autoload.php
536 /modules/ps_accounts/vendor/composer/autoload_real.php
537 /modules/ps_accounts/vendor/composer/platform_check.php
538 /modules/ps_accounts/vendor/composer/autoload_static.php
539 /modules/ps_accounts/vendor/paragonie/random_compat/lib/random.php
540 /modules/ps_accounts/vendor/symfony/polyfill-php70/bootstrap.php
541 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions_include.php
542 /modules/ps_accounts/vendor/guzzlehttp/promises/src/functions.php
543 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions_include.php
544 /modules/ps_accounts/vendor/guzzlehttp/psr7/src/functions.php
545 /modules/ps_accounts/vendor/symfony/polyfill-apcu/bootstrap.php
546 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions_include.php
547 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/functions.php
548 /modules/ps_accounts/vendor/phpseclib/phpseclib/phpseclib/bootstrap.php
549 /modules/gmerchantcenterpro/vendor/autoload.php
550 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
551 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
552 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
553 /modules/ganalyticspro/vendor/autoload.php
554 /modules/ganalyticspro/vendor/composer/autoload_real.php
555 /modules/ganalyticspro/vendor/composer/platform_check.php
556 /modules/ganalyticspro/vendor/composer/autoload_static.php
557 /modules/fattura24/vendor/autoload.php
558 /modules/fattura24/vendor/composer/autoload_real.php
559 /modules/fattura24/vendor/composer/autoload_static.php
560 /modules/payplug/vendor/autoload.php
561 /modules/payplug/vendor/composer/autoload_real.php
562 /modules/payplug/vendor/composer/autoload_static.php
563 /modules/sendinblue/vendor/autoload.php
564 /modules/sendinblue/vendor/composer/autoload_real.php
565 /modules/sendinblue/vendor/composer/platform_check.php
566 /modules/sendinblue/vendor/composer/autoload_static.php
567 /modules/gremarketing/vendor/autoload.php
568 /modules/gremarketing/vendor/composer/autoload_real.php
569 /modules/gremarketing/vendor/composer/platform_check.php
570 /modules/gremarketing/vendor/composer/autoload_static.php
571 /modules/feedaty/vendor/autoload.php
572 /modules/feedaty/vendor/composer/autoload_real.php
573 /modules/feedaty/vendor/composer/autoload_static.php
574 /modules/seoimg/vendor/autoload.php
575 /modules/seoimg/vendor/composer/autoload_real.php
576 /modules/seoimg/vendor/composer/platform_check.php
577 /modules/seoimg/vendor/composer/autoload_static.php
578 /modules/psrecaptcha/vendor/autoload.php
579 /modules/psrecaptcha/vendor/composer/autoload_real.php
580 /modules/psrecaptcha/vendor/composer/platform_check.php
581 /modules/psrecaptcha/vendor/composer/autoload_static.php
582 /modules/autoupgrade/vendor/autoload.php
583 /modules/autoupgrade/vendor/composer/autoload_real.php
584 /modules/autoupgrade/vendor/composer/autoload_static.php
585 /modules/lgcookieslaw/vendor/autoload.php
586 /modules/lgcookieslaw/vendor/composer/autoload_real.php
587 /modules/lgcookieslaw/vendor/composer/autoload_static.php
588 /src/Core/Localization/Locale/Repository.php
589 /src/Core/Localization/Locale/RepositoryInterface.php
590 /src/Core/Localization/CLDR/LocaleRepository.php
591 /src/Core/Localization/CLDR/LocaleDataSource.php
592 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
593 /src/Core/Data/Layer/AbstractDataLayer.php
594 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
595 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
596 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
597 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
598 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
599 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
600 /vendor/symfony/contracts/Cache/CacheTrait.php
601 /vendor/psr/cache/src/InvalidArgumentException.php
602 /vendor/psr/cache/src/CacheException.php
603 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
604 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
605 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
606 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
607 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
608 /src/Core/Localization/CLDR/Reader.php
609 /src/Core/Localization/CLDR/ReaderInterface.php
610 /src/Core/Localization/Currency/Repository.php
611 /src/Core/Localization/Currency/RepositoryInterface.php
612 /src/Core/Localization/Currency/CurrencyDataSource.php
613 /src/Core/Localization/Currency/DataSourceInterface.php
614 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
615 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
616 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
617 /src/Adapter/Currency/CurrencyDataProvider.php
618 /src/Core/Currency/CurrencyDataProviderInterface.php
619 /src/Adapter/LegacyContext.php
620 /src/Adapter/Tools.php
621 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
622 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
623 /vendor/prestashop/decimal/src/Operation/Rounding.php
624 /src/Core/Localization/Locale.php
625 /src/Core/Localization/LocaleInterface.php
626 /src/Core/Localization/Specification/Price.php
627 /src/Core/Localization/Specification/Number.php
628 /src/Core/Localization/Specification/NumberInterface.php
629 /src/Core/Localization/Specification/Factory.php
630 /src/Core/Localization/CLDR/LocaleData.php
631 /src/Core/Localization/CLDR/NumberSymbolsData.php
632 /src/Core/Localization/CLDR/CurrencyData.php
633 /src/Core/Localization/CLDR/Locale.php
634 /src/Core/Localization/CLDR/LocaleInterface.php
635 /src/Core/Localization/Specification/NumberSymbolList.php
636 /classes/Currency.php
637 /src/Core/Localization/Currency/LocalizedCurrencyId.php
638 /src/Core/Localization/Currency/CurrencyData.php
639 /src/Core/Localization/Currency/CurrencyCollection.php
640 /src/Core/Localization/Currency.php
641 /src/Core/Localization/CurrencyInterface.php
642 /src/Core/Localization/Specification/NumberCollection.php
643 /src/Core/Localization/Number/Formatter.php
644 /classes/Cart.php
645 /src/Adapter/AddressFactory.php
646 /classes/CartRule.php
647 /override/classes/Product.php
648 /classes/Product.php
649 /src/Core/Domain/Product/ValueObject/RedirectType.php
650 /src/Core/Util/DateTime/DateTime.php
651 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
652 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
653 /src/Core/Domain/Product/ValueObject/ProductType.php
654 /src/Core/Domain/Product/ValueObject/Reference.php
655 /src/Core/Domain/Product/ValueObject/Ean13.php
656 /src/Core/Domain/Product/ValueObject/Isbn.php
657 /src/Core/Domain/Product/ValueObject/Upc.php
658 /src/Core/Domain/Product/ProductSettings.php
659 /src/Core/Domain/Shop/ValueObject/ShopId.php
660 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
661 /modules/ps_emailsubscription/ps_emailsubscription.php
662 /src/Core/Module/WidgetInterface.php
663 /src/PrestaShopBundle/Translation/DomainNormalizer.php
664 /classes/Media.php
665 /modules/ps_emailalerts/ps_emailalerts.php
666 /modules/ps_emailalerts/MailAlert.php
667 /modules/ps_checkout/ps_checkout.php
668 /classes/PaymentModule.php
669 /modules/ps_checkout/translations/it.php
670 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
671 /modules/ps_checkout/vendor/prestashop/module-lib-cache-directory-provider/src/Cache/CacheDirectoryProvider.php
672 /modules/ps_checkout/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ContainerProvider.php
673 /var/cache/prod/Ps_checkout8400FrontContainer.php
674 /modules/ps_checkout/src/Validator/FrontControllerValidator.php
675 /modules/ps_checkout/src/Validator/MerchantValidator.php
676 /modules/ps_checkout/src/PayPal/PayPalConfiguration.php
677 /modules/ps_checkout/src/Configuration/PrestaShopConfiguration.php
678 /modules/ps_checkout/src/Configuration/PrestaShopConfigurationOptionsResolver.php
679 /modules/ps_checkout/src/Shop/ShopProvider.php
680 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/OptionsResolver.php
681 /vendor/symfony/symfony/src/Symfony/Component/OptionsResolver/Options.php
682 /modules/ps_checkout/src/Repository/PayPalCodeRepository.php
683 /modules/ps_checkout/src/Repository/PsAccountRepository.php
684 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Facade/PsAccounts.php
685 /modules/ps_checkout/vendor/prestashop/prestashop-accounts-installer/src/Installer/Installer.php
686 /src/Core/Addon/Module/ModuleManagerBuilder.php
687 /var/cache/prod/yaml/1deb99a1745c58282b5926d8d607faaa.php
688 /src/Adapter/LegacyLogger.php
689 /src/PrestaShopBundle/Service/DataProvider/Admin/CategoriesProvider.php
690 /src/Adapter/Module/ModuleDataProvider.php
691 /src/Adapter/Module/AdminModuleDataProvider.php
692 /src/PrestaShopBundle/Service/DataProvider/Admin/ModuleInterface.php
693 /src/Adapter/Module/Module.php
694 /src/Core/Module/ModuleInterface.php
695 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocator.php
696 /vendor/symfony/symfony/src/Symfony/Component/Config/FileLocatorInterface.php
697 /vendor/symfony/symfony/src/Symfony/Component/Routing/Loader/YamlFileLoader.php
698 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/FileLoader.php
699 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/Loader.php
700 /vendor/symfony/symfony/src/Symfony/Component/Config/Loader/LoaderInterface.php
701 /vendor/symfony/symfony/src/Symfony/Component/Routing/Router.php
702 /vendor/symfony/symfony/src/Symfony/Component/Routing/RouterInterface.php
703 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/UrlMatcherInterface.php
704 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContextAwareInterface.php
705 /vendor/symfony/symfony/src/Symfony/Component/Routing/Generator/UrlGeneratorInterface.php
706 /vendor/symfony/symfony/src/Symfony/Component/Routing/Matcher/RequestMatcherInterface.php
707 /vendor/symfony/symfony/src/Symfony/Component/Routing/RequestContext.php
708 /src/Adapter/Module/ModuleDataUpdater.php
709 /src/Core/Module/ModuleManager.php
710 /src/Core/Module/ModuleManagerInterface.php
711 /src/Core/Module/ModuleRepository.php
712 /src/Core/Module/ModuleRepositoryInterface.php
713 /src/Adapter/HookManager.php
714 /src/Core/Module/SourceHandler/SourceHandlerFactory.php
715 /src/PrestaShopBundle/Event/Dispatcher/NullDispatcher.php
716 /vendor/symfony/symfony/src/Symfony/Component/EventDispatcher/EventDispatcherInterface.php
717 /vendor/symfony/contracts/EventDispatcher/EventDispatcherInterface.php
718 /modules/ps_distributionapiclient/vendor/psr/event-dispatcher/src/EventDispatcherInterface.php
719 /src/Core/Hook/HookDispatcherInterface.php
720 /modules/ps_accounts/ps_accounts.php
721 /modules/ps_accounts/src/Hook/HookableTrait.php
722 /modules/ps_accounts/src/Module/Install.php
723 /modules/ps_accounts/translations/it.php
724 /modules/ps_accounts/src/DependencyInjection/ServiceContainer.php
725 /modules/ps_accounts/src/DependencyInjection/ContainerProvider.php
726 /var/cache/prod/Ps_accounts701FrontContainer.php
727 /modules/ps_accounts/src/Service/PsAccountsService.php
728 /modules/ps_accounts/src/Account/Session/Firebase/ShopSession.php
729 /modules/ps_accounts/src/Account/Session/Session.php
730 /modules/ps_accounts/src/Account/Session/SessionInterface.php
731 /modules/ps_accounts/src/Repository/ConfigurationRepository.php
732 /modules/ps_accounts/src/Adapter/Configuration.php
733 /modules/ps_accounts/src/Account/Session/ShopSession.php
734 /modules/ps_accounts/src/Account/Session/RefreshFirebaseTokens.php
735 /modules/ps_accounts/src/Provider/OAuth2/ShopProvider.php
736 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/PrestaShop.php
737 /modules/ps_accounts/vendor/league/oauth2-client/src/Provider/AbstractProvider.php
738 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/ArrayAccessorTrait.php
739 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/GuardedPropertyTrait.php
740 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/QueryBuilderTrait.php
741 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/BearerAuthorizationTrait.php
742 /modules/ps_accounts/vendor/prestashopcorp/oauth2-prestashop/src/Provider/LogoutTrait.php
743 /modules/ps_accounts/src/Provider/OAuth2/Oauth2Client.php
744 /modules/ps_accounts/src/Adapter/ConfigurationKeys.php
745 /modules/ps_accounts/src/Type/Enum.php
746 /modules/ps_accounts/src/Adapter/Link.php
747 /modules/ps_accounts/src/Context/ShopContext.php
748 /modules/ps_accounts/vendor/league/oauth2-client/src/Grant/GrantFactory.php
749 /modules/ps_accounts/vendor/league/oauth2-client/src/Tool/RequestFactory.php
750 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Client.php
751 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/ClientInterface.php
752 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/HandlerStack.php
753 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/Proxy.php
754 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlMultiHandler.php
755 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactory.php
756 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlFactoryInterface.php
757 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/CurlHandler.php
758 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Handler/StreamHandler.php
759 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/Middleware.php
760 /modules/ps_accounts/vendor/guzzlehttp/guzzle/src/RedirectMiddleware.php
761 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/PostAuthOptionProvider.php
762 /modules/ps_accounts/vendor/league/oauth2-client/src/OptionProvider/OptionProviderInterface.php
763 /modules/ps_accounts/src/Account/Session/Firebase/OwnerSession.php
764 /modules/ps_accounts/src/Account/LinkShop.php
765 /modules/ps_checkout/src/Context/PrestaShopContext.php
766 /modules/ps_checkout/src/ExpressCheckout/ExpressCheckoutConfiguration.php
767 /modules/ps_checkout/src/PayPal/PayPalPayLaterConfiguration.php
768 /modules/ps_checkout/src/Version/Version.php
769 /modules/psrecaptcha/psrecaptcha.php
770 /modules/psrecaptcha/translations/it.php
771 /classes/ProductDownload.php
772 /classes/tax/Tax.php
773 /src/Core/Localization/CLDR/ComputingPrecision.php
774 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
775 /src/Core/Cart/Calculator.php
776 /src/Core/Cart/CartRowCollection.php
777 /src/Core/Cart/Fees.php
778 /src/Core/Cart/AmountImmutable.php
779 /src/Core/Cart/CartRuleCollection.php
780 /src/Core/Cart/CartRuleCalculator.php
781 /src/Adapter/Product/PriceCalculator.php
782 /classes/order/Order.php
783 /src/Core/Cart/CartRow.php
784 /vendor/prestashop/decimal/src/DecimalNumber.php
785 /vendor/prestashop/decimal/src/Builder.php
786 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
787 /classes/Gender.php
788 /classes/Risk.php
789 /classes/Meta.php
790 /modules/revsliderprestashop/revsliderprestashop.php
791 /modules/revsliderprestashop/rev-loader.php
792 /modules/revsliderprestashop/includes/revslider_db.class.php
793 /modules/revsliderprestashop/includes/data.class.php
794 /modules/revsliderprestashop/includes/functions.class.php
795 /modules/revsliderprestashop/includes/em-integration.class.php
796 /modules/revsliderprestashop/includes/cssparser.class.php
797 /modules/revsliderprestashop/includes/woocommerce.class.php
798 /modules/revsliderprestashop/includes/wpml.class.php
799 /modules/revsliderprestashop/includes/colorpicker.class.php
800 /modules/revsliderprestashop/includes/navigation.class.php
801 /modules/revsliderprestashop/includes/object-library.class.php
802 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
803 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
804 /modules/revsliderprestashop/includes/extension.class.php
805 /modules/revsliderprestashop/includes/favorite.class.php
806 /modules/revsliderprestashop/includes/aq-resizer.class.php
807 /modules/revsliderprestashop/includes/external-sources.class.php
808 /modules/revsliderprestashop/includes/page-template.class.php
809 /modules/revsliderprestashop/includes/slider.class.php
810 /modules/revsliderprestashop/includes/slide.class.php
811 /modules/revsliderprestashop/includes/output.class.php
812 /modules/revsliderprestashop/public/revslider-front.class.php
813 /modules/revsliderprestashop/includes/backwards.php
814 /modules/revsliderprestashop/admin/includes/class-pclzip.php
815 /modules/revsliderprestashop/admin/includes/license.class.php
816 /modules/revsliderprestashop/admin/includes/addons.class.php
817 /modules/revsliderprestashop/admin/includes/template.class.php
818 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
819 /modules/revsliderprestashop/admin/includes/folder.class.php
820 /modules/revsliderprestashop/admin/includes/import.class.php
821 /modules/revsliderprestashop/admin/includes/export.class.php
822 /modules/revsliderprestashop/admin/includes/export-html.class.php
823 /modules/revsliderprestashop/admin/includes/newsletter.class.php
824 /modules/revsliderprestashop/admin/revslider-admin.class.php
825 /modules/revsliderprestashop/includes/update.class.php
826 /modules/revsliderprestashop/includes/resize-imag.php
827 /modules/revsliderprestashop/translations/it.php
828 /override/classes/Address.php
829 /classes/Address.php
830 /modules/arteinvoice/arteinvoice.php
831 /modules/arteinvoice/translations/it.php
832 /classes/ImageType.php
833 /classes/State.php
834 /src/Core/Security/PasswordPolicyConfiguration.php
835 /src/Core/Configuration/DataConfigurationInterface.php
836 /src/Core/Security/Hashing.php
837 /src/Core/Filter/FrontEndObject/MainFilter.php
838 /src/Core/Filter/FilterInterface.php
839 /src/Core/Filter/FrontEndObject/CartFilter.php
840 /src/Core/Filter/HashMapWhitelistFilter.php
841 /src/Core/Filter/CollectionFilter.php
842 /src/Core/Filter/FrontEndObject/ProductFilter.php
843 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
844 /src/Core/Filter/FrontEndObject/CustomerFilter.php
845 /src/Core/Filter/FrontEndObject/ShopFilter.php
846 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
847 /modules/lgcookieslaw/lgcookieslaw.php
848 /modules/lgcookieslaw/config/config.inc.php
849 /modules/lgcookieslaw/translations/it.php
850 /modules/lgcookieslaw/classes/LGCookiesLawPurpose.php
851 /vendor/defuse/php-encryption/src/Crypto.php
852 /vendor/defuse/php-encryption/src/KeyOrPassword.php
853 /vendor/defuse/php-encryption/src/RuntimeTests.php
854 /vendor/defuse/php-encryption/src/DerivedKeys.php
855 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
856 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
857 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
858 /var/cache/prod/smarty/compile/37/43/2c/37432c861bff16f5b2f4e73e17290a859706693a_2.file.view_cookies_scripts_content.tpl.php
859 /var/cache/prod/smarty/compile/19/c5/80/19c58092aad1b9d2c0faefe208b7555546f1a69f_2.file.view_header.tpl.php
860 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
861 /modules/ps_shoppingcart/ps_shoppingcart.php
862 /modules/productcomments/productcomments.php
863 /modules/iqitcompare/iqitcompare.php
864 /modules/iqitcompare/translations/it.php
865 /modules/iqitcontactpage/iqitcontactpage.php
866 /modules/iqitcontactpage/translations/it.php
867 /modules/iqitcountdown/iqitcountdown.php
868 /modules/iqitcountdown/translations/it.php
869 /modules/iqitelementor/iqitelementor.php
870 /modules/iqitelementor/src/IqitElementorLanding.php
871 /modules/iqitelementor/src/IqitElementorTemplate.php
872 /modules/iqitelementor/src/IqitElementorProduct.php
873 /modules/iqitelementor/src/IqitElementorCategory.php
874 /modules/iqitelementor/src/IqitElementorContent.php
875 /modules/iqitelementor/src/iqitElementorWpHelper.php
876 /modules/iqitelementor/includes/plugin-elementor.php
877 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
878 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
879 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
880 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
881 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
882 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
883 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
884 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
885 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
886 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
887 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
888 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
889 /modules/iqitelementor/translations/it.php
890 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
891 /modules/iqitfreedeliverycount/translations/it.php
892 /modules/iqitmegamenu/iqitmegamenu.php
893 /modules/iqitmegamenu/models/IqitMenuTab.php
894 /modules/iqitmegamenu/models/IqitMenuHtml.php
895 /modules/iqitmegamenu/models/IqitMenuLinks.php
896 /modules/iqitmegamenu/translations/it.php
897 /modules/iqitreviews/iqitreviews.php
898 /modules/iqitreviews/src/IqitProductReview.php
899 /modules/iqitwishlist/iqitwishlist.php
900 /modules/iqitwishlist/src/IqitWishlistProduct.php
901 /modules/iqitwishlist/translations/it.php
902 /modules/iqitextendedproduct/iqitextendedproduct.php
903 /modules/iqitextendedproduct/src/IqitThreeSixty.php
904 /modules/iqitextendedproduct/src/IqitProductVideo.php
905 /modules/iqitextendedproduct/translations/it.php
906 /modules/artproduttori/artproduttori.php
907 /modules/artproduttori/translations/it.php
908 /var/cache/prod/smarty/compile/shopwarehouse/2a/78/bf/2a78bfe324326a3e5b719fcedc43fa2217413e51_2.file.scriptV9.tpl.php
909 /modules/ganalyticspro/ganalyticspro.php
910 /modules/ganalyticspro/translations/it.php
911 /modules/ganalyticspro/lib/moduleTools.php
912 /modules/ganalyticspro/conf/moduleConfiguration.php
913 /modules/ganalyticspro/lib/hook/hookController.php
914 /modules/ganalyticspro/lib/hook/hookDisplay.php
915 /modules/ganalyticspro/lib/hook/hookInterface.php
916 /modules/ganalyticspro/lib/gtag/baseTag.php
917 /modules/ganalyticspro/lib/gtag/categoryTag.php
918 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
919 /classes/Combination.php
920 /classes/stock/StockAvailable.php
921 /classes/SpecificPrice.php
922 /classes/tax/TaxManagerFactory.php
923 /classes/tax/TaxRulesTaxManager.php
924 /classes/tax/TaxManagerInterface.php
925 /classes/tax/TaxCalculator.php
926 /classes/GroupReduction.php
927 /classes/Pack.php
928 /override/classes/Manufacturer.php
929 /classes/Manufacturer.php
930 /classes/Tag.php
931 /modules/ganalyticspro/models/orderRefund.php
932 /modules/ganalyticspro/models/orderPartialRefund.php
933 /var/cache/prod/smarty/compile/shopwarehouse/1c/84/58/1c8458cc9d4e9ed9c19ec87cbfcb12174e2707f9_2.file.header.tpl.php
934 /var/cache/prod/smarty/compile/shopwarehouse/b4/00/ef/b400eff9187b1d53d67faeda1e6035db24007b26_2.file.apichatgpt.tpl.php
935 /var/cache/prod/smarty/compile/shopwarehouse/67/1c/ce/671ccec8ce19597b0b74aa75c89c3e503b4f00be_2.file.head.tpl.php
936 /modules/shinystat/shinystat.php
937 /modules/shinystat/translations/it.php
938 /modules/ets_integrategooglemarketing/ets_integrategooglemarketing.php
939 /modules/ets_integrategooglemarketing/classes/Ets_integrategooglemarketing_defines.php
940 /modules/ets_integrategooglemarketing/translations/it.php
941 /var/cache/prod/smarty/compile/shopwarehouse/a5/b7/a4/a5b7a45ca285fcbfe2b88dceb9824ebefab6b6ac_2.file.google_tag_head.tpl.php
942 /var/cache/prod/smarty/compile/shopwarehouse/ce/33/81/ce33814f2d98ddedf15ce7084df0cb6273514cb7_2.file.google_search_console.tpl.php
943 /modules/cdc_googletagmanager/cdc_googletagmanager.php
944 /modules/cdc_googletagmanager/classes/CdcGtmOrderLog.php
945 /modules/cdc_googletagmanager/services/CdcTools.php
946 /modules/cdc_googletagmanager/services/PrestashopUtils.php
947 /modules/cdc_googletagmanager/classes/DataLayer.php
948 /modules/cdc_googletagmanager/classes/gtm/Ecommerce.php
949 /modules/cdc_googletagmanager/classes/gtm/DataLayerProduct.php
950 /modules/cdc_googletagmanager/services/Gtm_Product.php
951 /modules/cdc_googletagmanager/classes/gtm/Refund.php
952 /modules/cdc_googletagmanager/classes/gtm/GoogleTagParams.php
953 /modules/cdc_googletagmanager/classes/gtm_ga4/DataLayerItem.php
954 /modules/cdc_googletagmanager/translations/it.php
955 /modules/gremarketing/gremarketing.php
956 /modules/gremarketing/lib/moduleTools.php
957 /modules/gremarketing/translations/it.php
958 /modules/gremarketing/conf/moduleConfiguration.php
959 /modules/gremarketing/lib/hook/hookController.php
960 /modules/gremarketing/lib/hook/hookDisplay.php
961 /modules/gremarketing/lib/hook/hookBase.php
962 /modules/gmerchantcenterpro/gmerchantcenterpro.php
963 /modules/gmerchantcenterpro/translations/it.php
964 /modules/gmerchantcenterpro/lib/moduleTools.php
965 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
966 /modules/gmerchantcenterpro/lib/moduleUpdate.php
967 /modules/gmerchantcenterpro/lib/install/installController.php
968 /modules/gmerchantcenterpro/lib/install/installSql.php
969 /modules/gmerchantcenterpro/lib/install/installInterface.php
970 /modules/gmerchantcenterpro/models/Feeds.php
971 /modules/gremarketing/lib/tags/baseDynTag.php
972 /modules/gremarketing/lib/tags/dynamicCategoryTag.php
973 /var/cache/prod/smarty/compile/shopwarehouse/2f/9e/ea/2f9eea5170ce390e3df3ef367d69faf4aa1dac49_2.file.header.tpl.php
974 /modules/connettore/connettore.php
975 /modules/connettore/configurazione/configurazione_connettore.php
976 /modules/connettore/classes/AnubiLogger.php
977 /modules/connettore/classes/AnubiDbPDO.php
978 /modules/connettore/classes/DbWrapper.php
979 /modules/connettore/classes/BaseTask.php
980 /modules/connettore/classes/DbConnettore.php
981 /modules/connettore/classes/WebHelper.php
982 /modules/connettore/classes/Utils.php
983 /modules/connettore/classes/TestataOrdine.php
984 /modules/connettore/classes/RigaOrdine.php
985 /modules/connettore/tasks/TestTask.php
986 /modules/connettore/tasks/ImportazioneDatiTask.php
987 /modules/connettore/tasks/ImportazioneNuoveCategorieTask.php
988 /modules/connettore/tasks/AggiornamentoCategorieTask.php
989 /modules/connettore/tasks/ImportazioneNuoveFunzioniTask.php
990 /modules/connettore/tasks/ImportazioneNuoviProdottiTask.php
991 /modules/connettore/tasks/AggiornamentoProdottiTask.php
992 /modules/connettore/tasks/ImportazioneImmaginiProdottoTask.php
993 /modules/connettore/tasks/AttivazioneProdottiTask.php
994 /modules/connettore/tasks/AggiornamentoDisponibilitaTask.php
995 /modules/connettore/tasks/ImportazioneNuoviManufacturerTask.php
996 /modules/connettore/tasks/EliminaProdottiCheNonEsistonoTask.php
997 /modules/connettore/tasks/ImportazioneCorrelatiTask.php
998 /modules/connettore/tasks/AggiornamentoTagTask.php
999 /modules/connettore/tasks/AggiornamentoGiacenzeTask.php
1000 /modules/connettore/tasks/IndicizzazioneProdottiTask.php
1001 /modules/connettore/translations/it.php
1002 /modules/feedaty/feedaty.php
1003 /modules/feedaty/translations/it.php
1004 /modules/feedaty/it.php
1005 /modules/feedaty/lib/FeedatyClasses.php
1006 /modules/feedaty/lib/FeedatyWebservice.php
1007 /modules/feedaty/lib/FeedatyPositions.php
1008 /modules/feedaty/lib/FeedatyProtocols.php
1009 /modules/feedaty/lib/FeedatyGenerateElements.php
1010 /modules/feedaty/lib/FeedatyCsvController.php
1011 /modules/tec_dataminimizer/tec_dataminimizer.php
1012 /modules/ec_minorder/ec_minorder.php
1013 /modules/ec_minorder/translations/it.php
1014 /modules/multipleprices/multipleprices.php
1015 /modules/multipleprices/classes/MultiplepricesConfiguration.php
1016 /modules/multipleprices/translations/it.php
1017 /var/cache/prod/smarty/compile/shopwarehouse/1e/5b/1e/1e5b1ed75e7d2edf5948921999bdb0cfc282f073_2.file.styles.tpl.php
1018 /modules/payplug/payplug.php
1019 /modules/payplug/translations/it.php
1020 /modules/payplug/classes/PayPlugDependencies.php
1021 /modules/payplug/classes/DependenciesClass.php
1022 /modules/payplug/src/utilities/validators/accountValidator.php
1023 /modules/payplug/src/utilities/validators/browserValidator.php
1024 /modules/payplug/src/utilities/validators/cardValidator.php
1025 /modules/payplug/src/utilities/validators/lockValidator.php
1026 /modules/payplug/src/utilities/validators/loggerValidator.php
1027 /modules/payplug/src/utilities/validators/moduleValidator.php
1028 /modules/payplug/src/utilities/validators/orderValidator.php
1029 /modules/payplug/src/utilities/validators/paymentValidator.php
1030 /modules/payplug/src/utilities/helpers/AmountHelper.php
1031 /modules/payplug/src/utilities/helpers/ConfigurationHelper.php
1032 /modules/payplug/src/utilities/helpers/CookiesHelper.php
1033 /modules/payplug/src/utilities/helpers/FilesHelper.php
1034 /modules/payplug/src/utilities/helpers/PhoneHelper.php
1035 /modules/payplug/src/utilities/helpers/UserHelper.php
1036 /modules/payplug/src/application/dependencies/PluginInit.php
1037 /modules/payplug/src/application/dependencies/BaseClass.php
1038 /modules/payplug/src/actions/CardAction.php
1039 /modules/payplug/src/actions/CartAction.php
1040 /modules/payplug/src/actions/ConfigurationAction.php
1041 /modules/payplug/src/actions/MerchantTelemetryAction.php
1042 /modules/payplug/src/actions/OnboardingAction.php
1043 /modules/payplug/src/actions/OneyAction.php
1044 /modules/payplug/src/actions/OrderAction.php
1045 /modules/payplug/src/actions/RefundAction.php
1046 /modules/payplug/src/actions/OrderStateAction.php
1047 /modules/payplug/src/actions/PaymentAction.php
1048 /modules/payplug/src/models/entities/CacheEntity.php
1049 /modules/payplug/src/models/entities/OneyEntity.php
1050 /modules/payplug/src/models/entities/PluginEntity.php
1051 /modules/payplug/src/models/entities/OrderStateEntity.php
1052 /modules/payplug/src/application/adapter/AddressAdapter.php
1053 /modules/payplug/src/interfaces/AddressInterface.php
1054 /modules/payplug/src/application/adapter/AssignAdapter.php
1055 /modules/payplug/src/interfaces/AssignInterface.php
1056 /modules/payplug/src/application/adapter/CarrierAdapter.php
1057 /modules/payplug/src/interfaces/CarrierInterface.php
1058 /classes/Carrier.php
1059 /modules/payplug/src/application/adapter/CartAdapter.php
1060 /modules/payplug/src/interfaces/CartInterface.php
1061 /modules/payplug/src/application/adapter/ConfigurationAdapter.php
1062 /modules/payplug/src/interfaces/ConfigurationInterface.php
1063 /modules/payplug/src/application/adapter/ConstantAdapter.php
1064 /modules/payplug/src/interfaces/ConstantInterface.php
1065 /modules/payplug/src/application/adapter/ContextAdapter.php
1066 /modules/payplug/src/interfaces/ContextInterface.php
1067 /modules/payplug/src/application/adapter/CountryAdapter.php
1068 /modules/payplug/src/interfaces/CountryInterface.php
1069 /modules/payplug/src/application/adapter/CurrencyAdapter.php
1070 /modules/payplug/src/interfaces/CurrencyInterface.php
1071 /modules/payplug/src/application/adapter/CustomerAdapter.php
1072 /modules/payplug/src/interfaces/CustomerInterface.php
1073 /modules/payplug/src/application/adapter/DispatcherAdapter.php
1074 /modules/payplug/src/interfaces/DispatcherInterface.php
1075 /modules/payplug/src/application/adapter/LanguageAdapter.php
1076 /modules/payplug/src/interfaces/LanguageInterface.php
1077 /modules/payplug/src/application/adapter/MediaAdapter.php
1078 /modules/payplug/src/interfaces/MediaInterface.php
1079 /modules/payplug/src/application/adapter/MessageAdapter.php
1080 /modules/payplug/src/interfaces/MessageInterface.php
1081 /modules/payplug/src/application/adapter/ModuleAdapter.php
1082 /modules/payplug/src/interfaces/ModuleInterface.php
1083 /modules/payplug/src/application/adapter/OrderAdapter.php
1084 /modules/payplug/src/interfaces/OrderInterface.php
1085 /modules/payplug/src/application/adapter/OrderHistoryAdapter.php
1086 /modules/payplug/src/interfaces/OrderHistoryInterface.php
1087 /modules/payplug/src/application/adapter/OrderSlipAdapter.php
1088 /modules/payplug/src/interfaces/OrderSlipInterface.php
1089 /modules/payplug/src/application/adapter/OrderStateAdapter.php
1090 /modules/payplug/src/interfaces/OrderStateInterface.php
1091 /classes/order/OrderState.php
1092 /modules/payplug/src/application/adapter/ProductAdapter.php
1093 /modules/payplug/src/interfaces/ProductInterface.php
1094 /modules/payplug/src/application/adapter/QueryAdapter.php
1095 /modules/payplug/src/interfaces/QueryInterface.php
1096 /modules/payplug/src/application/adapter/ShopAdapter.php
1097 /modules/payplug/src/interfaces/ShopInterface.php
1098 /modules/payplug/src/application/adapter/TabAdapter.php
1099 /modules/payplug/src/interfaces/TabInterface.php
1100 /modules/payplug/src/application/adapter/ToolsAdapter.php
1101 /modules/payplug/src/interfaces/ToolsInterface.php
1102 /modules/payplug/src/application/adapter/TranslationAdapter.php
1103 /modules/payplug/src/interfaces/TranslationInterface.php
1104 /modules/payplug/src/application/adapter/ValidateAdapter.php
1105 /modules/payplug/src/interfaces/ValidateInterface.php
1106 /modules/payplug/src/models/classes/Address.php
1107 /modules/payplug/src/models/classes/ApiRest.php
1108 /modules/payplug/src/models/classes/Configuration.php
1109 /modules/payplug/src/models/classes/Country.php
1110 /modules/payplug/src/models/classes/Order.php
1111 /modules/payplug/src/models/classes/paymentMethod/PaymentMethod.php
1112 /modules/payplug/src/models/classes/Translation.php
1113 /modules/payplug/src/models/repositories/CardRepository.php
1114 /modules/payplug/src/models/repositories/QueryRepository.php
1115 /modules/payplug/src/models/repositories/CacheRepository.php
1116 /modules/payplug/src/models/repositories/CountryRepository.php
1117 /modules/payplug/src/models/repositories/LockRepository.php
1118 /modules/payplug/src/models/repositories/LoggerRepository.php
1119 /modules/payplug/src/models/repositories/ModuleRepository.php
1120 /modules/payplug/src/models/repositories/OrderRepository.php
1121 /modules/payplug/src/models/repositories/OrderStateRepository.php
1122 /modules/payplug/src/models/repositories/OrderPaymentRepository.php
1123 /modules/payplug/src/models/repositories/PaymentRepository.php
1124 /modules/payplug/src/models/repositories/PayplugOrderStateRepository.php
1125 /modules/payplug/src/models/repositories/ShopRepository.php
1126 /modules/payplug/classes/MyLogPHP.php
1127 /modules/payplug/src/repositories/LoggerRepository.php
1128 /modules/payplug/src/models/entities/LoggerEntity.php
1129 /modules/payplug/src/repositories/TranslationsRepository.php
1130 /modules/payplug/src/repositories/SQLtableRepository.php
1131 /modules/payplug/src/repositories/CacheRepository.php
1132 /modules/payplug/src/repositories/OrderStateRepository.php
1133 /modules/payplug/src/repositories/InstallRepository.php
1134 /modules/payplug/src/utilities/services/API.php
1135 /modules/payplug/src/utilities/services/Browser.php
1136 /modules/payplug/src/utilities/services/Routes.php
1137 /modules/payplug/src/utilities/services/MerchantTelemetry.php
1138 /modules/payplug/classes/ApiClass.php
1139 /modules/payplug/classes/ApplePayClass.php
1140 /modules/payplug/classes/AmountCurrencyClass.php
1141 /modules/payplug/classes/AdminClass.php
1142 /modules/payplug/classes/PayplugLock.php
1143 /modules/payplug/classes/CartClass.php
1144 /modules/payplug/classes/ConfigClass.php
1145 /modules/payplug/classes/InstallmentClass.php
1146 /modules/payplug/classes/HookClass.php
1147 /modules/payplug/classes/MediaClass.php
1148 /modules/payplug/classes/OrderClass.php
1149 /modules/payplug/classes/PaymentClass.php
1150 /modules/payplug/classes/RefundClass.php
1151 /vendor/symfony/symfony/src/Symfony/Component/Dotenv/Dotenv.php
1152 /modules/payplug/src/application/adapter/PrestashopAdapter17.php
1153 /modules/sendinblue/sendinblue.php
1154 /modules/sendinblue/translations/it.php
1155 /modules/sendinblue/services/ConfigService.php
1156 /modules/absfrequentlyboughttogether/absfrequentlyboughttogether.php
1157 /modules/absfrequentlyboughttogether/class/AbsBuyItWith.php
1158 /modules/absfrequentlyboughttogether/class/AbsPromoFqb.php
1159 /modules/absfrequentlyboughttogether/translations/it.php
1160 /modules/trustedprogramintegration/trustedprogramintegration.php
1161 /modules/trustedprogramintegration/translations/it.php
1162 /src/Core/Product/Search/ProductSearchContext.php
1163 /src/Core/Product/Search/ProductSearchQuery.php
1164 /src/Core/Product/Search/SortOrder.php
1165 /modules/ps_facetedsearch/ps_facetedsearch.php
1166 /modules/ps_facetedsearch/src/HookDispatcher.php
1167 /modules/ps_facetedsearch/src/Hook/Attribute.php
1168 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
1169 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
1170 /modules/ps_facetedsearch/src/Hook/Category.php
1171 /modules/ps_facetedsearch/src/Hook/Configuration.php
1172 /modules/ps_facetedsearch/src/Hook/Design.php
1173 /modules/ps_facetedsearch/src/Hook/Feature.php
1174 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
1175 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
1176 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
1177 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
1178 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
1179 /modules/ps_facetedsearch/src/Hook/Product.php
1180 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
1181 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
1182 /modules/ps_facetedsearch/src/Filters/Provider.php
1183 /modules/ps_facetedsearch/src/URLSerializer.php
1184 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
1185 /modules/ps_facetedsearch/src/Product/SearchProvider.php
1186 /src/Core/Product/Search/FacetsRendererInterface.php
1187 /src/Core/Product/Search/ProductSearchProviderInterface.php
1188 /modules/ps_facetedsearch/src/Filters/Converter.php
1189 /modules/ps_facetedsearch/src/Product/SearchFactory.php
1190 /src/Core/Product/Search/ProductSearchResult.php
1191 /modules/ps_facetedsearch/src/Product/Search.php
1192 /modules/ps_facetedsearch/src/Adapter/MySQL.php
1193 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
1194 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
1195 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
1196 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
1197 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
1198 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
1199 /modules/ps_facetedsearch/src/Filters/Products.php
1200 /modules/ps_facetedsearch/src/Filters/Block.php
1201 /modules/ps_facetedsearch/src/Definition/Availability.php
1202 /src/Core/Util/String/StringModifier.php
1203 /src/Core/Util/String/StringModifierInterface.php
1204 /src/Core/Product/Search/Facet.php
1205 /src/Core/Product/Search/Filter.php
1206 /src/Core/Product/Search/FacetCollection.php
1207 /classes/ProductAssembler.php
1208 /classes/ProductPresenterFactory.php
1209 /src/Adapter/Presenter/Product/ProductListingPresenter.php
1210 /src/Adapter/Presenter/Product/ProductPresenter.php
1211 /src/Adapter/Product/ProductColorsRetriever.php
1212 /src/Core/Product/ProductPresentationSettings.php
1213 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
1214 /src/Adapter/Presenter/Product/ProductLazyArray.php
1215 /src/Adapter/Presenter/AbstractLazyArray.php
1216 /classes/Image.php
1217 /src/Core/Image/ImageFormatConfiguration.php
1218 /src/Core/Image/ImageFormatConfigurationInterface.php
1219 /classes/FeatureFlag.php
1220 /src/Core/FeatureFlag/FeatureFlagSettings.php
1221 /src/Core/Util/Inflector.php
1222 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
1223 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
1224 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
1225 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
1226 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
1227 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
1228 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
1229 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
1230 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
1231 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
1232 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
1233 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
1234 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
1235 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
1236 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
1237 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
1238 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
1239 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
1240 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
1241 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
1242 /var/cache/prod/smarty/compile/shopwarehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
1243 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
1244 /vendor/smarty/smarty/libs/plugins/modifier.count.php
1245 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
1246 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
1247 /var/cache/prod/smarty/compile/shopwarehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
1248 /src/Core/Product/Search/Pagination.php
1249 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f8/11/cb/f811cb95a71b2aadd97e674a0f709876f06d4c42_2.file.category.tpl.php
1250 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
1251 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/b2/a5/fe/b2a5fee663562893eda7670099e89eec5d81a1fb_2.file.product-list.tpl.php
1252 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/dd/fe/b9/ddfeb954e222c722253739f7845703c29eaea402_2.file.layout-left-column.tpl.php
1253 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5a/ce/e5/5acee588265771a51ffc84701e00bdd02c9abdf2_2.file.layout-both-columns.tpl.php
1254 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c5/08/43/c508439c1a96a30f9de64446737e6ee1927dfb3b_2.file.helpers.tpl.php
1255 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
1256 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/6f/91/236f91d2776e44271e012c43db1c691696c15040_2.file.head.tpl.php
1257 /vendor/smarty/smarty/libs/sysplugins/smarty_undefined_variable.php
1258 /var/cache/prod/smarty/compile/shopwarehouse/27/e9/b0/27e9b031b55351a9f084c5addac17fcde073133e_2.file.gtm_tag.tpl.php
1259 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/fb/db/48/fbdb48daf1e14bbe07fd3699d645f11debb2eb1a_2.file.head-jsonld.tpl.php
1260 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/16/ce/59/16ce59339f787d6cb8ac4f7c0a7f20e99de1b839_2.file.product-list-jsonld.tpl.php
1261 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/0a/0b/4c/0a0b4c89241f913d59419ea9a3612aa6515190d1_2.file.pagination-seo.tpl.php
1262 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
1263 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/b9/7c/beb97cb450a9f69fd43c061d99fbdfad7181c6f6_2.file.stylesheets.tpl.php
1264 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ae/4d/30/ae4d30f43146c6e1ffaee0607d30f548b596517f_2.file.javascript.tpl.php
1265 /var/cache/prod/smarty/compile/shopwarehouse/46/35/48/463548647f97f9e2cce954b7188c1f350dab323f_2.file.google_tag_body.tpl.php
1266 /var/cache/prod/smarty/compile/shopwarehouse/5d/db/c8/5ddbc86a06a0a0d6e76e4f9fba4952f2f24c5192_2.file.gtm_tag_noscript.tpl.php
1267 /var/cache/prod/smarty/compile/27/a8/a7/27a8a764939f2f3d8f7490893049eba541e593c2_2.file.view_after_body_opening_tag_header.tpl.php
1268 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/98/20/ef/9820ef0925d3fee40988d8cee22dbe868c6cb068_2.file.product-activation.tpl.php
1269 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/8c/bc/41/8cbc41da8acb85d754b2c50cfefb91ed607a9edf_2.file.header.tpl.php
1270 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e9/b9/d5/e9b9d508f2dd480341846be452ac6f6672284f34_2.file.social-links.tpl.php
1271 /modules/iqitlinksmanager/iqitlinksmanager.php
1272 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
1273 /modules/iqitlinksmanager/src/IqitLinkBlock.php
1274 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
1275 /modules/iqitlinksmanager/translations/it.php
1276 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
1277 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
1278 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
1279 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayNav1/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1280 /modules/iqithtmlandbanners/iqithtmlandbanners.php
1281 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerRepository.php
1282 /modules/iqithtmlandbanners/src/IqitHtmlAndBannerPresenter.php
1283 /modules/iqithtmlandbanners/src/IqitHtmlAndBanner.php
1284 /modules/iqithtmlandbanners/translations/it.php
1285 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayNavCenter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1286 /modules/ps_languageselector/ps_languageselector.php
1287 /modules/ps_currencyselector/ps_currencyselector.php
1288 /var/cache/prod/smarty/compile/shopwarehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
1289 /var/cache/prod/smarty/compile/shopwarehouse/a7/b4/2a/a7b42a5e4e0a5166bfca3e9be0e40e49bcdd454f_2.module.iqitcompareviewstemplateshookdisplaynav.tpl.php
1290 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/9a/e8/a0/9ae8a0bf6f8a38863b91cfc212bb6ceb2292b8a7_2.file.header-1.tpl.php
1291 /modules/iqitsearch/iqitsearch.php
1292 /modules/iqitsearch/translations/it.php
1293 /var/cache/prod/smarty/compile/shopwarehouse/78/3c/e0/783ce0bc99544193d9645b02e003b32e879d6a43_2.module.iqitsearchviewstemplateshookiqitsearch.tpl.php
1294 /var/cache/prod/smarty/compile/shopwarehouse/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
1295 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/23/5e/3f/235e3f5ee59d64225af247fb2228e65cd3fe7fb0_2.module.ps_shoppingcartps_shoppingcartdefault.tpl.php
1296 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
1297 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
1298 /modules/ps_customersignin/ps_customersignin.php
1299 /var/cache/prod/smarty/compile/shopwarehouse/d5/f8/f5/d5f8f570180f74d1dbdd1a1d2af0445e90a6650c_2.module.ps_customersigninps_customersignin.tpl.php
1300 /modules/pagesnotfound/pagesnotfound.php
1301 /var/cache/prod/smarty/compile/shopwarehouse/63/ba/59/63ba5972c9730522e9fb200398edbc11f4f58089_2.file.feedaty-widget-store.tpl.php
1302 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/10/shopwarehouse/a8/34/6d/a8346d2dc5b79e1534b3385fa0faac4b475b9eb4.iqitmegamenuviewstemplateshookhorizontal.tpl.php
1303 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/1c/e5/92/1ce5928ab8218bc3ddcd60c352dd1d71893f7908_2.file.mobile-header-3.tpl.php
1304 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
1305 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
1306 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
1307 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/62/43/78/624378c7dfeb412830a19d0b0b37a8715548f5cf_2.file.breadcrumb.tpl.php
1308 /modules/iqitproductsnav/iqitproductsnav.php
1309 /modules/iqitproductsnav/translations/it.php
1310 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/5e/e2/b8/5ee2b817b44046586c6272340d6af59d1a367ad4_2.file.notifications.tpl.php
1311 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/89/a9/18/89a918329b56f1c800efdd755b39ba9f219ec921_2.file.category-header.tpl.php
1312 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/ef/6d/4c/ef6d4c7a880f80029c6b448812468d37383ff042_2.file.category-subcategories.tpl.php
1313 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/26/2c/5e/262c5ee15c17f10153d38421d802f53b3a380c71_2.file.products-top.tpl.php
1314 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
1315 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c9/f1/91/c9f191209eb3f477d74071d448cc161f10778b3c_2.file.sort-orders.tpl.php
1316 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/c1/47/e9/c147e97b1ab26489e3f10827386d1bcd455d4114_2.file.products.tpl.php
1317 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/b9/de/a6b9dee9c985ceb3eeded4c44440dc98077b6366_2.file.product-list.tpl.php
1318 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/82/b8/3a/82b83aed6eab9dedf4c24a9d0b1f481ebb09cd2c_2.file.product-miniature-thumb.tpl.php
1319 /var/cache/prod/smarty/compile/shopwarehouse/f0/28/06/f0280617ea95e2794fe002b1120fc56cfd448619_2.module.iqitreviewsviewstemplateshooksimpleproductrating.tpl.php
1320 /vendor/smarty/smarty/libs/plugins/function.math.php
1321 /var/cache/prod/smarty/compile/shopwarehouse/54/50/60/54506057f821234b35c479582bc2dc0b2fc98e35_2.file.artlistproduttori-ps17.tpl.php
1322 /vendor/smarty/smarty/libs/plugins/modifier.date_format.php
1323 /classes/ProductSupplier.php
1324 /vendor/prestashop/decimal/src/Operation/Addition.php
1325 /var/cache/prod/smarty/compile/shopwarehouse/a9/94/a3/a994a3c5a500481515bc7b0596a4818bfcc60e9d_2.file.text.tpl.php
1326 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/e5/37/94/e5379437e7cb07eac35c6b76d06b8bbdd09277e9_2.file.product-miniature-btn.tpl.php
1327 /var/cache/prod/smarty/compile/shopwarehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
1328 /var/cache/prod/smarty/compile/shopwarehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
1329 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/a6/4d/f5/a64df5b4b109264f55bc8c441b2ddd649e00fe0b_2.file.pagination.tpl.php
1330 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/7d/c7/b9/7dc7b920724d67c85c9a1148ffc6e1352c81c741_2.file.products-bottom.tpl.php
1331 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_updatecache.php
1332 /var/cache/prod/smarty/compile/shopwarehouse/85/b4/27/85b427a04c9571c52bce3e03ca48c19c59f0ab89_2.file.related_posts_category.tpl.cache.php
1333 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_codeframe.php
1334 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_writefile.php
1335 /var/cache/prod/smarty/cache/ybc_blog/7878/1/1/1/10/240508/shopwarehouse/ce/42/62/ce4262669d57a99fd312a58083a030ff04f2f417.related_posts_category.tpl.php
1336 /modules/ps_categorytree/ps_categorytree.php
1337 /var/cache/prod/smarty/compile/shopwarehouse/89/21/00/8921007f54626fc7fe42cbff53f1d70828d3393d_2.module.ps_categorytreeviewstemplateshookps_categorytree.tpl.php
1338 /var/cache/prod/smarty/compile/shopwarehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
1339 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/31/e3/1e/31e31e2f9e0e15e082e36c94e3ce506f8b52318b_2.file.footer.tpl.php
1340 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/59/d8/c5/59d8c5b4bd8f7dc7e77b4b784cf989309f96e9a6_2.file.footer-2.tpl.php
1341 /var/cache/prod/smarty/cache/iqithtmlandbanners/1/1/1/10/displayFooter/shopwarehouse/4f/04/b8/4f04b8224a1c82addef02187e981c55ca6e71758.iqithtmlandbannersviewstemplateshookiqithtmlandbanners.tpl.php
1342 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/10/displayFooter/shopwarehouse/5a/2b/1d/5a2b1d66e3342213736e8a253a78b30fbc716172.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
1343 /var/cache/prod/smarty/cache/iqitcontactpage/1/1/1/10/shopwarehouse/31/45/63/3145630ee48f34c64dce20915cd36a7d798fa52b.iqitcontactpageviewstemplateshookiqitcontactpageblock.tpl.php
1344 /var/cache/prod/smarty/compile/shopwarehouse/59/fa/4a/59fa4a468746e7397894d4d55728b7a0399415fc_2.file.artinvoice_js.tpl.php
1345 /var/cache/prod/smarty/compile/shopwarehouse/c8/59/18/c85918ff6d9da0aabb89af560f45f255349ce95e_2.file.footer.tpl.php
1346 /modules/lgcookieslaw/classes/LGCookiesLawCookie.php
1347 /classes/CMS.php
1348 /var/cache/prod/smarty/compile/b1/74/ee/b174ee22d35566f04bb92c3cdb14885c864f06e9_2.file.view_banner.tpl.php
1349 /var/cache/prod/smarty/compile/shopwarehouse/76/b6/77/76b677d100d34eed3ff7a027ae76cd2d2caafd5f_2.file.shinystat.tpl.php
1350 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/f3/e2/01/f3e201110b395deed6ef05594261db3284242b23_2.file.footer-copyrights-1.tpl.php
1351 /var/cache/prod/smarty/compile/shopwarehouselayouts_layout_left_column_tpl/d2/ed/33/d2ed337060b8ed3aaacc807eb44ca9f06bc7740c_2.file.password-policy-template.tpl.php
1352 /classes/form/CustomerLoginForm.php
1353 /classes/form/AbstractForm.php
1354 /classes/form/FormInterface.php
1355 /src/Core/Foundation/Templating/RenderableInterface.php
1356 /classes/form/CustomerLoginFormatter.php
1357 /classes/form/FormFormatterInterface.php
1358 /classes/ValidateConstraintTranslator.php
1359 /src/Core/Util/InternationalizedDomainNameConverter.php
1360 /src/Core/Foundation/Templating/RenderableProxy.php
1361 /var/cache/prod/smarty/compile/shopwarehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
1362 /classes/form/FormField.php
1363 /var/cache/prod/smarty/compile/shopwarehouse/22/1c/83/221c831891cf43068d82e5d2cedfd7083701554e_2.file.login-form.tpl.php
1364 /var/cache/prod/smarty/compile/shopwarehouse/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1365 /var/cache/prod/smarty/compile/8f/74/7a/8f747aa7caf4a60dae1415d8fc15828b2e6a2977_2.file.form-fields.tpl.php
1366 /var/cache/prod/smarty/compile/c1/db/a8/c1dba82f8977fc625757c9c858748ce660dba8d6_2.file.form-errors.tpl.php
1367 /var/cache/prod/smarty/compile/shopwarehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
1368 /modules/statsdata/statsdata.php
1369 /classes/Guest.php
1370 /classes/Connection.php
1371 /classes/Page.php
1372 /classes/ConnectionsSource.php